Domain assigned by cuff on 12 Feb 2008 16:18
same superfamily
CATH Domain: 2imrA02
2imrA02
PDB 2imr, Chain A, Domain 2
Segment boundaries for domain 2imrA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2imrA01 | 34 | 45 |
| 2imrA01 | 51 | 90 |
| 2imrA01 | 400 | 416 |
| 2imrA02 | 46 | 50 |
| 2imrA02 | 91 | 399 |
Structural Neighbourhood (4 entries)
There are 4 matching structural neighberhood comparisons for CATH ID 3.20.20.140.10.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 4 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1p1mA02 | 83.75 | 3.20.20.140 | 281 | 17 | 84 | 3.78 | 4.46 | |
|
2i9uA02 | 83.50 | 3.20.20.140 | 308 | 14 | 90 | 4.21 | 4.65 | |
|
2pajA02 | 81.77 | 3.20.20.140 | 276 | 25 | 79 | 3.76 | 4.72 | |
|
2oodA02 | 81.42 | 3.20.20.140 | 318 | 13 | 87 | 4.32 | 4.96 |
[1]
Displaying entries 1 to 4 (page 1 of 1)
Domain ATOM Sequence
>pdb|2imrA02 TGPPPVNAHTHLDMSAYEFQALPYFQWIPEVVIRGRHLRGVAAAQAGADTLTRLGAGGVGDIVWAPEVMDALLAREDLSG TLYFEVLNPFPDKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTELEM FRTGGGPLWDNRMPALYPHTLAEVIGREPGPDLTPVRYLDELGVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNH HLECGTFDWPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVGTPF
Domain COMBS Sequence
>pdb|2imrA02 TGPPPVNAHTHLDMSAYEFQALPYFQWIPEVVIRGRHLRGVAAAQAGADTLTRLGAGGVGDIVWAPEVMDALLAREDLSG TLYFEVLNPFPDKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTELEM FRTGGGPLWDNRMPALYPHTLAEVIGREPGPDLTPVRYLDELGVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNH HLECGTFDWPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVGGRTPF
Domain History Events (59)
Domain assignment manual match h by cuff on 12 Feb 2008 16:17
nice scores. enough evidence for homology
Domain assignment manual match t by tronnberg on 12 Sep 2007 10:13
SSAP: 83.75 OV: 84 SEQ: 17. Very similar linkage and structure. The query's function is unknown. I believe that 2i9uA02 (TBA) should be assigned to the same topology.
Homcheck review by tronnberg on 12 Sep 2007 10:13
SSAP: 83.75 OV: 84 SEQ: 17. Very similar linkage and structure. The query's function is unknown. I believe that 2i9uA02 (TBA) should be assigned to the same topology.
Flow stage update by tronnberg on 12 Sep 2007 10:13
SSAP: 83.75 OV: 84 SEQ: 17. Very similar linkage and structure. The query's function is unknown. I believe that 2i9uA02 (TBA) should be assigned to the same topology.
Homcheck allotment by tronnberg on 12 Sep 2007 10:00
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 12 Sep 2007 10:00
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 12 Sep 2007 07:39
Domain "2imrA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 12 Sep 2007 07:37
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2imrA02
Flow stage update by auto on 12 Sep 2007 07:29
Retrieved PRC_PFAMCATH results for job ID SID4029048326050600 and results inserted.
Domain scan prc pfamcath by auto on 12 Sep 2007 07:28
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 82 results for 2imrA02
Update comment by auto on 12 Sep 2007 03:13
PRC_PFAMCATH job SID4029048326050600 is not yet finished.
Flow stage update by auto on 12 Sep 2007 03:12
The entry "2imrA02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 12 Sep 2007 03:12
The entry "2imrA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 12 Sep 2007 02:25
Retrieved SSAP results for job ID SID4837261797488296 and results inserted.
Domain scan ssap cath by auto on 12 Sep 2007 02:23
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 399 results for 2imrA02
Update comment by auto on 09 Sep 2007 22:59
SSAP job SID4837261797488296 is not yet finished.
Flow stage update by auto on 09 Sep 2007 22:13
The entry "2imrA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Sep 2007 22:13
The entry "2imrA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 19:23
Giving up on SSAP job SID5367143951866040 because submission time of Wed Sep 5 15:54:45 2007 is more than 345600 seconds older than current time (Sun Sep 9 19:23:02 2007).
Update comment by auto on 05 Sep 2007 19:26
SSAP job SID5367143951866040 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:54
The entry "2imrA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:54
The entry "2imrA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 07:26
Retrieved PRC results for job ID SID3137409945718784 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 07:25
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2imrA02
Flow stage update by auto on 05 Sep 2007 03:31
The entry "2imrA02" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:31
The entry "2imrA02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 16:11
Retrieved HMM(SAM) results for job ID SID6995542231492640 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 16:11
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 2imrA02
Update comment by auto on 04 Sep 2007 11:40
HMM(SAM) job SID6995542231492640 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:45
The entry "2imrA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:45
The entry "2imrA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 23:09
Retrieved "2imrA02" CATHEDRAL results for job ID SID0613520392065120 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 23:08
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2imrA02
Flow stage update by auto on 03 Sep 2007 13:52
The entry "2imrA02" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:52
The entry "2imrA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:49
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2imrA02.scanlist" for "2imrA02"
Write scan list by auto on 03 Sep 2007 11:48
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2imrA02.scanlist" for domain "2imrA02"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:13
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:30
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:58
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2imrA02" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2imrA02"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2imrA02"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2imrA02"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
