Domain assigned by cuff on 12 Feb 2008 16:32
i agree. same superfamily
CATH Domain: 2imrA01
2imrA01
PDB 2imr, Chain A, Domain 1
Segment boundaries for domain 2imrA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2imrA01 | 34 | 45 |
| 2imrA01 | 51 | 90 |
| 2imrA01 | 400 | 416 |
| 2imrA02 | 46 | 50 |
| 2imrA02 | 91 | 399 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 2.30.40.10.22.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1gkrA01 | 78.81 | 2.30.40.10 | 87 | 13 | 73 | 3.14 | 4.27 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2imrA01 HTPRLLTCDVLYAQSPGGVVVVGETVAAAGHPDELRRQYPHAAEERAGAVIALRRGETWQEGFRWELSR
Domain History Events (54)
Domain assignment manual match h by rupa on 10 Sep 2007 15:08
Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.
Homcheck review by rupa on 10 Sep 2007 15:08
Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.
Flow stage update by rupa on 10 Sep 2007 15:08
Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.
Homcheck allotment by rupa on 10 Sep 2007 11:36
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 10 Sep 2007 11:36
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 08:14
Domain "2imrA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 08:13
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2imrA01
Flow stage update by auto on 08 Sep 2007 07:59
Retrieved PRC_PFAMCATH results for job ID SID4426295982125944 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 07:58
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2imrA01
Update comment by auto on 08 Sep 2007 04:03
PRC_PFAMCATH job SID4426295982125944 is not yet finished.
Flow stage update by auto on 08 Sep 2007 03:50
The entry "2imrA01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 08 Sep 2007 03:50
The entry "2imrA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 02:55
Retrieved SSAP results for job ID SID6002004594520000 and results inserted.
Domain scan ssap cath by auto on 08 Sep 2007 02:53
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1838 results for 2imrA01
Update comment by auto on 05 Sep 2007 19:26
SSAP job SID6002004594520000 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:54
The entry "2imrA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:54
The entry "2imrA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 07:25
Retrieved PRC results for job ID SID7097804602268704 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 07:24
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2imrA01
Prc cath submit by auto on 05 Sep 2007 03:31
The entry "2imrA01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:31
The entry "2imrA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 16:11
Retrieved HMM(SAM) results for job ID SID8933880071940552 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 16:10
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2imrA01
Update comment by auto on 04 Sep 2007 11:40
HMM(SAM) job SID8933880071940552 is not yet finished.
Flow stage update by auto on 04 Sep 2007 09:45
The entry "2imrA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 09:45
The entry "2imrA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 23:08
Retrieved "2imrA01" CATHEDRAL results for job ID SID6577289535829728 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 23:07
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 106 results for 2imrA01
Cathedral cath submit by auto on 03 Sep 2007 13:52
The entry "2imrA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:52
The entry "2imrA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:48
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2imrA01.scanlist" for "2imrA01"
Write scan list by auto on 03 Sep 2007 11:48
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2imrA01.scanlist" for domain "2imrA01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:13
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:30
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 31 Aug 2007 19:58
No satisfactory AssignClose result found.
Flow stage update by auto on 31 Aug 2007 19:48
No in_process hits for Domain "2imrA01" ready to be processed
Flow stage update by auto on 31 Aug 2007 19:48
NW result present for Domain "2imrA01"
Flow stage update by auto on 24 Aug 2007 10:05
All required files are present for Domain "2imrA01"
Flow stage update by auto on 23 Aug 2007 18:40
Beginning processing for Domain "2imrA01"
Insertion by cuff on 23 Aug 2007 11:57
nice chopping
