CATH Domain: 2imjD01 XML data for domain: 2imjD01

Molscript image for 2imjD01
2imjD01
PDB coordinates for domain 2imjD01

PDB 2imj, Chain D, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.6
3.10.450.50.6.1
3.10.450.50.6.1.1
3.10.450.50.6.1.1.1
3.10.450.50.6.1.1.1.1

Segment boundaries for domain 2imjD01

Chopping figure for domain 2imjD01
DomainStart PDB ResidueStop PDB Residue
2imjD01 15 156

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.10.450.50.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ohpA00 85.64 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 12 82 2.07 2.50
1jkgA00 83.96 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 7 77 2.93 3.76
3dm8A00 83.51 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 6 82 3.70 4.50
1gy6A00 83.51 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 4 80 3.33 4.16
1tuhA00 82.59 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 12 84 3.53 4.19
1of5B00 81.92 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 3 79 2.74 3.46
3b7cA00 81.30 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 9 76 2.51 3.28
2ux0B00 80.89 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 8 77 2.95 3.79
1idpA00 79.81 Scytalone dehydrataseMagnaporthe grisea 3.10.450.50 147 6 79 3.15 3.96
2owpA00 79.68 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 12 75 3.37 4.49
1q42A00 78.44 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 3 74 3.28 4.42
3blzA00 77.47 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 8 77 3.62 4.69
3cnxA00 77.24 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 8 79 3.49 4.40
3bb9B00 76.06 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 5 80 3.36 4.20
2r4iA00 75.69 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 7 77 3.64 4.68
Displaying entries 1 to 15 (page 1 of 1)


Domain ATOM Sequence

>pdb|2imjD01
TRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYA
YEWHDDSGNWFRSYGNENWEFDEQGLARRFACINDPIKAQERKFHWPLGRRPDDHPGLSE    

Domain COMBS Sequence

>pdb|2imjD01
TRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYA
YEWHDDSGNWFRSYGNENWEFDEQGLXARRFACINDXPIKAQERKFHWPLGRRPDDHPGLSELGLEHHHHHH    

Domain History Events (14)

Domain assigned by auto on 06 Mar 2008 14:29

Assigning to "3.10.450.50" based on similarity with "2imjA01"

Flow stage update by auto on 06 Mar 2008 14:27

No in_process hits for Domain "2imjD01" ready to be processed

Update comment by auto on 06 Mar 2008 14:25

Domain "2imjD01" hits Domain "2imjA01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 06 Mar 2008 14:14

Domain "2imjD01" hits Domain "2imjC01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Update comment by auto on 29 Jul 2007 23:16

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Flow stage update by auto on 29 Jul 2007 23:08

Domain "2imjD01" hits Domain "2imjB01" (98.6111111111111% over 94.7368421052632%) which is currently in process

Flow stage update by auto on 29 Jul 2007 23:08

NW result present for Domain "2imjD01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2imjD01"

Flow stage update by auto on 10 Jul 2007 16:02

Beginning processing for Domain "2imjD01"

Insertion by auto on 10 Jul 2007 16:01

Final ChopClose added based on similarity with "2imjA"