Domain assigned by cuff on 21 Feb 2008 11:16
same superfamily
CATH Domain: 2imhA01
2imhA01
PDB 2imh, Chain A, Domain 1
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2imhA01 SLTFSILAHDPETGAIGGAAATGSLCVGGWVLRGDLNAGSASQGAAPSTFWGEEVLQHLRDGSHPEDAVNHVTSQDSGRA YRQLAADLLGNAAAFTGSENQDIKGSVTFASGIASGNLGDNSVLGATEAFVASDLTFERRLLAALIAAEGAGGLLSAALV LHPDRPPVTLRIDYHPDNPIGALEQLYQKATTGDYADWARQVPVLSDK
Domain History Events (72)
Domain assignment manual match h by cuff on 21 Feb 2008 11:14
same superfamily in SCOP, good structural comparison
Domain assignment manual match t by rupa on 10 Sep 2007 15:03
Good ssap score, same fold, unknown function.
Homcheck review by rupa on 10 Sep 2007 15:03
Good ssap score, same fold, unknown function.
Flow stage update by rupa on 10 Sep 2007 15:03
Good ssap score, same fold, unknown function.
Homcheck allotment by rupa on 10 Sep 2007 11:35
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 10 Sep 2007 11:35
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 23:40
Domain "2imhA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 23:39
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2imhA01
Flow stage update by auto on 08 Sep 2007 23:26
Retrieved PRC_PFAMCATH results for job ID SID2046126394207196 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 23:25
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2imhA01
Update comment by auto on 08 Sep 2007 19:26
PRC_PFAMCATH job SID2046126394207196 is not yet finished.
Prc pfamcath submit by auto on 08 Sep 2007 19:17
The entry "2imhA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 19:17
The entry "2imhA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 18:13
Retrieved SSAP results for job ID SID2217214442937440 and results inserted.
Domain scan ssap cath by auto on 08 Sep 2007 18:12
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 71 results for 2imhA01
Update comment by auto on 05 Sep 2007 19:26
SSAP job SID2217214442937440 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:55
The entry "2imhA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:55
The entry "2imhA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 07:31
Retrieved PRC results for job ID SID0151867139695808 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 07:30
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2imhA01
Flow stage update by auto on 05 Sep 2007 03:32
The entry "2imhA01" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:32
The entry "2imhA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 16:16
Retrieved HMM(SAM) results for job ID SID5538037174054584 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 16:15
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2imhA01
Update comment by auto on 04 Sep 2007 11:40
HMM(SAM) job SID5538037174054584 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:45
The entry "2imhA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:45
The entry "2imhA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 23:13
Retrieved "2imhA01" CATHEDRAL results for job ID SID0263200464504928 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 23:12
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 525 results for 2imhA01
Flow stage update by auto on 03 Sep 2007 13:52
The entry "2imhA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:52
The entry "2imhA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:49
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2imhA01.scanlist" for "2imhA01"
Write scan list by auto on 03 Sep 2007 11:49
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2imhA01.scanlist" for domain "2imhA01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:36
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:21
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:15
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:13
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:30
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:05
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:16
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:35
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:15
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:22
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:28
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:32
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:49
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:11
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:20
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:20
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:13
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:13
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 14:11
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 14:04
No in_process hits for Domain "2imhA01" ready to be processed
Flow stage update by auto on 27 Aug 2007 14:04
NW result present for Domain "2imhA01"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2imhA01"
Flow stage update by auto on 16 Aug 2007 17:14
Beginning processing for Domain "2imhA01"
Insertion by cuff on 16 Aug 2007 15:45
nice chopping
