CATH Domain: 2ikkA00

2ikkA00

PDB 2ikk, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.1410	Chorismate lyase
3.40.1410.10	Chorismate lyase	Gene3D
3.40.1410.10.2
3.40.1410.10.2.1
3.40.1410.10.2.1.1
3.40.1410.10.2.1.1.1
3.40.1410.10.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2ikkA00

Domain	Start PDB Residue	Stop PDB Residue
2ikkA00	83	238

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.2.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3cnvA01	88.80	GntR family transcriptional regulatorBordetella bronchisepticaPutative GntR-family transcriptional regulator	3.40.1410.10	150	19	92	3.42	3.69
3ddvB01	88.45	GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis	3.40.1410.10	137	22	94	2.86	3.03
2p19A01	87.57	Corynebacterium glutamicumBacterial regulatory proteins, gntR family	3.40.1410.10	130	23	88	3.28	3.69
3bwgC02	86.82	GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK	3.40.1410.10	155	18	92	2.56	2.77
2pkhB01	86.52	Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor	3.40.1410.10	129	16	88	3.72	4.22
2fa1A00	86.21	GntR family transcriptional regulator, phosphonate transport system regulatory proteinProbable transcriptional regulator phnFEscherichia coli K-12	3.40.1410.10	159	17	90	2.25	2.48
3eetB02	85.18	Streptomyces avermitilisPutative GntR-family transcriptional regulator	3.40.1410.10	161	16	83	2.24	2.67
2oggA01	85.06	GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor	3.40.1410.10	133	12	91	3.84	4.19
2nwiB00	83.13	Archaeoglobus fulgidusPutative uncharacterized protein	3.40.1410.10	151	13	85	3.36	3.93

[top]
Domain ATOM Sequence

>pdb|2ikkA00
GTENLYFQHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQPLTFEVTHYPLDLFPGIDTFIADGVSHDILKQQ
YKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDKTAFTSNDQPIYCSLFLHTNRVTFTIN

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2ikkA00
XHHHHHHSSGVDLGTENLYFQSNASTGKKPKHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQPLTFEVTHYP
LDLFPGIDTFIADGVSXHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDKTAFTSNDQPIYCSLFLXH
TNRVTFTINSPYT

BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 14 May 2008 14:16

Assigning to "3.40.1410.10" based on similarity with "2ikkB00"