CATH Domain: 2ikbB00 XML data for domain: 2ikbB00

Molscript image for 2ikbB00
2ikbB00
PDB coordinates for domain 2ikbB00

PDB 2ikb, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.141 Chitosanase, subunit A; domain 1
1.20.141.10 Chitosanase, subunit A, domain 1 Gene3D
1.20.141.10.1
1.20.141.10.1.1
1.20.141.10.1.1.1
1.20.141.10.1.1.1.1
1.20.141.10.1.1.1.1.1

Segment boundaries for domain 2ikbB00

Chopping figure for domain 2ikbB00
DomainStart PDB ResidueStop PDB Residue
2ikbB00 3 163

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2ikbB00
DKFNQFINRVLSHEGGYANHPKDPGGETNWGITKRTAQANGYNGSRATREQAISIYRKAFWERYRADQPEAVAFQFFDAC
VNHGYGNAARLQRAAGVPDDGVIGAVSLKAINSLPENDLLLRFNAERLVFYTKLKGWVRRVAQNLIHASA    

Domain COMBS Sequence

>pdb|2ikbB00
XSDKFNQFINRVLSHEGGYANHPKDPGGETNWGITKRTAQANGYNGSXRAXTREQAISIYRKAFWERYRADQXPEAVAFQ
FFDACVNHGYGNAARXLQRAAGVPDDGVIGAVSLKAINSLPENDLLLRFNAERLVFYTKLGTFTSFGKGWVRRVAQNLIH
ASADNTD    

Domain History Events (14)

Domain assigned by auto on 10 Apr 2008 15:49

Assigning to "1.20.141.10" based on similarity with "2ikbA00"

Flow stage update by auto on 10 Apr 2008 15:35

No in_process hits for Domain "2ikbB00" ready to be processed

Update comment by auto on 10 Apr 2008 15:21

Domain "2ikbB00" hits Domain "2ikbA00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 10 Apr 2008 15:07

Domain "2ikbB00" hits Domain "2ikbC00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Update comment by auto on 27 Jun 2007 22:03

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Flow stage update by auto on 14 May 2007 10:03

Domain "2ikbB00" hits Domain "2ikbD00" (97.0059880239521% over 100%) which is currently in process

Flow stage update by auto on 14 May 2007 10:03

NW result present for Domain "2ikbB00"

Flow stage update by auto on 13 May 2007 02:15

All required files are present for Domain "2ikbB00"

Flow stage update by auto on 12 May 2007 06:01

Beginning processing for Domain "2ikbB00"

Insertion by auto on 12 May 2007 05:57

Final ChopClose added based on similarity with "2ikbA"