CATH Domain: 2ij2B00 XML data for domain: 2ij2B00

Molscript image for 2ij2B00
2ij2B00
PDB coordinates for domain 2ij2B00

PDB 2ij2, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.630 Cytochrome p450
1.10.630.10 Cytochrome p450 Gene3D
1.10.630.10.3
1.10.630.10.3.1
1.10.630.10.3.1.1
1.10.630.10.3.1.1.1
1.10.630.10.3.1.1.1.1

[top]
Segment boundaries for domain 2ij2B00

Chopping figure for domain 2ij2B00
DomainStart PDB ResidueStop PDB Residue
2ij2B00 5 461

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.10.630.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tqnA00 83.13 Vitamin D 24-hydroxylase activityCell surfaceSteroid bindingSteroid hormone biosynthesisMetabolic pathways 1.10.630.10 468 24 92 3.48 3.78
1n97A00 82.48 Thermus thermophilus HB27Cytochrome P450 1.10.630.10 385 23 84 2.60 3.07
3czhA00 81.08 Vitamin D 25-hydroxylaseHomo sapiensCytochrome P450, family 2, subfamily R 1.10.630.10 465 20 91 3.61 3.94
1cptA00 80.66 Pseudomonas sp.Cytochrome P450-terp 1.10.630.10 412 16 85 3.00 3.50
2cibA00 80.39 Steroid biosynthesisMetabolic pathwaysLanosterol 14-alpha demethylaseCytochrome P450, family 51 (sterol 14-demethylase) [EC:1.14.13.70]Mycobacterium tuberculosis 1.10.630.10 419 18 86 4.32 4.99
1q5dA00 79.91 Epothilone biosynthetic processCytochrome P450 167A1Sorangium cellulosum 1.10.630.10 401 18 85 3.88 4.55
1lfkA00 79.67 Amycolatopsis orientalisCytochrome P450 165B3 1.10.630.10 375 14 81 3.18 3.89
2z3tA00 79.61 Cytochrome P450Streptomyces sp. TP-A0274 1.10.630.10 385 17 83 3.71 4.44
1odoA00 79.19 Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 395 19 84 3.44 4.09
1izoA00 78.67 Bacillus subtilisLimonene and pinene degradationNaphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationCytochrome P450 152A1 1.10.630.10 411 14 87 3.61 4.12
1t2bA00 78.57 Citrobacter braakiiP450cin 1.10.630.10 397 13 85 3.51 4.11
1io7A00 78.50 Sulfolobus acidocaldariusCytochrome P450 119[EC:1.14.14.-] 1.10.630.10 366 19 76 3.23 4.21
2zbxA00 78.49 Streptomyces griseolusCytochrome P450-SU1 1.10.630.10 398 14 84 3.91 4.61
1s1fA00 78.42 Biflaviolin synthase [EC:1.14.21.7]Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 397 14 83 3.37 4.03
2zwuA00 77.53 Camphor 5-monooxygenasePseudomonas putida 1.10.630.10 394 15 83 3.81 4.54
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ij2B00
MPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGD
GLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNAEHIEVPEDMTRLTLDTIGLCGFNYRFNSF
YRDQPHPFITSMVRALDEAMNKLQRYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDE
NIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFS
LYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLV
LGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ij2B00
TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRD
FAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNY
RFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNG
KDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNE
ALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRAC
IGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKV
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 17 Dec 2006 07:32

Assigning to "1.10.630.10" based on similarity with "2hpdA00"

Flow stage update by auto on 17 Dec 2006 07:31

No in_process hits for Domain "2ij2B00" ready to be processed

Update comment by auto on 17 Dec 2006 03:31

Domain "2ij2B00" hits Domain "2ij3B00" (99.7872340425532% over 100%) which is currently in process

Update comment by auto on 16 Dec 2006 23:36

Domain "2ij2B00" hits Domain "2ij4A00" (99.7872340425532% over 100%) which is currently in process

Update comment by auto on 16 Dec 2006 19:32

Domain "2ij2B00" hits Domain "2ij4B00" (99.7872340425532% over 100%) which is currently in process

Flow stage update by auto on 16 Dec 2006 19:31

Domain "2ij2B00" hits Domain "2ij4B00" (99.7872340425532% over 100%) which is currently in process

Flow stage update by auto on 16 Dec 2006 19:31

NW result present for Domain "2ij2B00"

Flow stage update by auto on 14 Dec 2006 15:49

All required files are present for Domain "2ij2B00"

Flow stage update by auto on 13 Dec 2006 15:37

Beginning processing for Domain "2ij2B00"

Insertion by auto on 13 Dec 2006 15:30

Final ChopClose added based on similarity with "2ij2A"