CATH Domain: 2ihtA03 XML data for domain: 2ihtA03

Molscript image for 2ihtA03
2ihtA03
PDB coordinates for domain 2ihtA03

PDB 2iht, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.970 Gene3D
3.40.50.970.11
3.40.50.970.11.1
3.40.50.970.11.1.1
3.40.50.970.11.1.1.1
3.40.50.970.11.1.1.1.1

[top]
Segment boundaries for domain 2ihtA03

Chopping figure for domain 2ihtA03
DomainStart PDB ResidueStop PDB Residue
2ihtA01 11 195
2ihtA02 196 359
2ihtA03 360 573

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.970.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ybhA03 87.85 ChloroplastAcetolactate synthase I/II/III large subunit [EC:2.2.1.6]Acetolactate synthase, chloroplasticValine, leucine and isoleucine biosynthesisMetabolic pathways 3.40.50.970 194 24 87 2.27 2.59
1ozhB03 87.22 Acetolactate synthase, catabolicKlebsiella pneumoniae 3.40.50.970 196 22 90 2.44 2.70
1t9bA03 86.10 Acetolactate synthase I/II/III large subunit [EC:2.2.1.6]Metabolic pathwaysValine, leucine and isoleucine biosynthesisButanoate metabolismFlavin adenine dinucleotide binding 3.40.50.970 228 22 85 2.49 2.90
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ihtA03
DIEPLRARIAEFLADPETYEDGRVHQVIDSNTVEEAAEPGEGTIVSDIGFFRHYGVLFARADQPFGFLTSAGCSSFGYGI
PAAIGAQARPDQPTFLIAGDGGFHSNSSDLETIARLNLPIVTVVVNNDTNGLIELYQNIGHHRSHDPAVKFGGVDFVALA
EANGVDATRATNREELLAALRKGAELGRPFLIEVPVNYDFQPGGFGALSI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ihtA03
DIEPLRARIAEFLADPETYEDGXRVHQVIDSXNTVXEEAAEPGEGTIVSDIGFFRHYGVLFARADQPFGFLTSAGCSSFG
YGIPAAIGAQXARPDQPTFLIAGDGGFHSNSSDLETIARLNLPIVTVVVNNDTNGLIELYQNIGHHRSHDPAVKFGGVDF
VALAEANGVDATRATNREELLAALRKGAELGRPFLIEVPVNYDFQPGGFGALSI
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 26 Nov 2007 03:04

Assigning to "3.40.50.970" based on similarity with "2ihtB03"

Flow stage update by auto on 26 Nov 2007 03:03

No in_process hits for Domain "2ihtA03" ready to be processed

Update comment by auto on 26 Nov 2007 03:01

Domain "2ihtA03" hits Domain "2ihtB03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 26 Nov 2007 02:58

Domain "2ihtA03" hits Domain "2ihvD03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 26 Nov 2007 02:55

Domain "2ihtA03" hits Domain "2ihvB03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 26 Nov 2007 02:52

Domain "2ihtA03" hits Domain "2ihvC03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 26 Nov 2007 02:48

Domain "2ihtA03" hits Domain "2ihtD03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 26 Nov 2007 02:39

Domain "2ihtA03" hits Domain "2ihvA03" (98.1308411214953% over 100%) which is currently in process

Update comment by auto on 25 Nov 2007 22:27

Domain "2ihtA03" hits Domain "2ihtC03" (98.1308411214953% over 100%) which is currently in process

Flow stage update by auto on 25 Nov 2007 22:17

Domain "2ihtA03" hits Domain "2ihtC03" (98.1308411214953% over 100%) which is currently in process

Flow stage update by auto on 25 Nov 2007 22:17

NW result present for Domain "2ihtA03"

Flow stage update by auto on 24 Nov 2007 14:37

All required files are present for Domain "2ihtA03"

Flow stage update by auto on 24 Nov 2007 02:36

Beginning processing for Domain "2ihtA03"

Insertion by auto on 23 Nov 2007 19:03

Final ChopClose added based on similarity with "1upaA"