CATH Domain: 2igiB00 XML data for domain: 2igiB00

Molscript image for 2igiB00
2igiB00
PDB coordinates for domain 2igiB00

PDB 2igi, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.5
3.30.420.10.5.1
3.30.420.10.5.1.1
3.30.420.10.5.1.1.1
3.30.420.10.5.1.1.1.1

[top]
Segment boundaries for domain 2igiB00

Chopping figure for domain 2igiB00
DomainStart PDB ResidueStop PDB Residue
2igiB00 2 180

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qxfA01 82.52 Mismatch repairExodeoxyribonuclease I [EC:3.1.11.1]Exodeoxyribonuclease IExodeoxyribonuclease I activityDNA catabolic process 3.30.420.10 192 15 84 2.91 3.43
2f96A00 81.86 Pseudomonas aeruginosaRibonuclease TRibonuclease T [EC:3.1.13.-] 3.30.420.10 196 12 88 4.04 4.58
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2igiB00
ANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQSDEQLALMDDWNVRTHTASGLVERVKASTMGD
REAELATLEFLKQWVPAGKSPICGNSIGQDRRFLFKYMPELEAYFHYRYLDVSTLKELARRWKPEILDGFTKQGTHQAMD
DIRESVAELAYYREHFIKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2igiB00
SANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQSDEQLALMDDWNVRTHTASGLVERVKASTMG
DREAELATLEFLKQWVPAGKSPICGNSIGQDRRFLFKYMPELEAYFHYRYLDVSTLKELARRWKPEILDGFTKQGTHQAM
DDIRESVAELAYYREHFIKL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 26 Nov 2007 02:40

Assigning to "3.30.420.10" based on similarity with "2igiA00"

Flow stage update by auto on 26 Nov 2007 02:39

No in_process hits for Domain "2igiB00" ready to be processed

Update comment by auto on 25 Nov 2007 22:27

Domain "2igiB00" hits Domain "2igiA00" (100% over 100%) which is currently in process

Flow stage update by auto on 25 Nov 2007 22:17

Domain "2igiB00" hits Domain "2igiA00" (100% over 100%) which is currently in process

Flow stage update by auto on 25 Nov 2007 22:17

NW result present for Domain "2igiB00"

Flow stage update by auto on 24 Nov 2007 14:37

All required files are present for Domain "2igiB00"

Flow stage update by auto on 24 Nov 2007 02:36

Beginning processing for Domain "2igiB00"

Insertion by auto on 23 Nov 2007 18:06

Final ChopClose added based on similarity with "2igiA"