CATH Domain: 2ifxA01 XML data for domain: 2ifxA01

Molscript image for 2ifxA01
2ifxA01
PDB coordinates for domain 2ifxA01

PDB 2ifx, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.100 Gene3D
3.30.70.100.10
3.30.70.100.10.1
3.30.70.100.10.1.1
3.30.70.100.10.1.1.1
3.30.70.100.10.1.1.1.1

[top]
Segment boundaries for domain 2ifxA01

Chopping figure for domain 2ifxA01
DomainStart PDB ResidueStop PDB Residue
2ifxA01 0 44
2ifxA01 62 104

Structural Neighbourhood (37 entries)

There are 37 matching structural neighberhood comparisons for CATH ID 3.30.70.100.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 37 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pd1A01 82.75 Nitrosomonas europaeaPutative uncharacterized protein 3.30.70.900 93 8 84 2.75 3.24
1yjrA00 81.66 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Cellular copper ion homeostasisTrans-Golgi network 3.30.70.100 75 5 85 3.76 4.40
3bdeA00 81.52 Mll5499 proteinMesorhizobium loti 3.30.70.900 93 14 84 2.47 2.91
2fb0A00 81.22 Bacteroides thetaiotaomicronPutative uncharacterized protein 3.30.70.900 91 13 87 3.12 3.55
3bguA01 81.08 Thermobifida fusca YXPutative uncharacterized protein 3.30.70.900 95 14 78 2.99 3.79
1iujB00 80.87 TT1380 proteinThermus thermophilus 3.30.70.900 103 12 79 3.30 4.15
2od4B01 80.64 3.30.70.900 81 9 91 3.05 3.33
3bn7A00 80.06 Caulobacter vibrioidesPutative uncharacterized protein 3.30.70.900 96 8 83 2.79 3.35
2g9oA00 80.06 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Trans-Golgi networkCellular copper ion homeostasis 3.30.70.100 77 2 85 3.72 4.36
2ofhX00 80.00 Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]Zinc-transporting ATPaseSynechocystis sp. PCC 6803 3.30.70.100 71 5 81 3.22 3.94
2j8sA07 79.78 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1440 94 7 81 3.73 4.55
1mwyA00 79.54 Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]Detoxification of zinc ionLead, cadmium, zinc and mercury-transporting ATPaseEscherichia coli K-12Response to cadmium ion 3.30.70.100 73 8 85 3.67 4.30
1rjjA00 79.47 Arabidopsis thalianaUncharacterized protein At5g22580Chloroplast 3.30.70.900 110 9 72 2.74 3.77
2x3dF01 79.05 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 10 83 3.32 3.98
3bb5D00 78.97 Jannaschia sp. CCS1Stress responsive alpha-beta 3.30.70.900 102 15 75 3.24 4.29
2rilA00 78.87 Antibiotic biosynthesis monooxygenaseShewanella loihica PV-4 3.30.70.900 91 13 82 3.49 4.23
2ftrA00 78.75 Bacillus haloduransBH0200 protein 3.30.70.900 92 18 82 4.03 4.88
2pgcA01 78.62 3.30.70.900 95 10 77 2.88 3.70
2od6A00 78.35 3.30.70.900 104 14 76 3.54 4.60
1lq9A00 78.11 Biosynthesis of type II polyketide productsStreptomyces coelicolorActVA 6 protein 3.30.70.900 112 10 73 3.48 4.75
1y3jA00 77.97 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Cellular copper ion homeostasisTrans-Golgi network 3.30.70.100 77 6 86 4.10 4.74
1opzA00 77.74 Cu2+-exporting ATPase [EC:3.6.3.4]Bacillus subtilisCopper-exporting P-type ATPase A 3.30.70.100 76 14 82 3.58 4.32
3c19A01 77.73 Methanopyrus kandleriUncharacterized conserved protein 3.30.70.1380 98 7 71 3.36 4.70
1tr0A00 77.67 Populus tremulaStable protein 1 3.30.70.900 106 12 74 3.31 4.44
3bf4A01 77.15 Ralstonia eutropha JMP134Ethyl tert-butyl ether degradation EthD 3.30.70.900 92 10 83 3.51 4.19
2bopA00 76.99 Regulatory protein E2Bovine papillomavirus type 1 3.30.70.330 85 3 77 3.63 4.67
2qmwA03 76.80 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 6 80 3.77 4.68
1r8hA00 76.68 Human papillomavirus type 6aRegulatory protein E2 3.30.70.330 87 6 75 3.42 4.51
2pgcA02 76.42 3.30.70.900 102 4 72 3.21 4.42
1tuvA00 76.20 Probable quinol monooxygenase ygiNProtein bindingEscherichia coli K-12 3.30.70.900 103 10 71 3.20 4.45
2hiyB01 75.83 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.1280 87 10 88 4.21 4.76
1harA02 75.58 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 1 81 3.97 4.86
2pn6A02 75.57 150aa long hypothetical transcriptional regulatorSulfolobus tokodaii 3.30.70.920 98 8 71 3.50 4.90
2oauA03 75.31 Small conductance mechanosensitive ion channel, MscS familySmall-conductance mechanosensitive channelMechanically-gated ion channel activityIntegral to membraneEscherichia coli K-12 3.30.70.100 86 6 77 3.87 4.97
2j8sA03 75.22 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1320 100 10 78 3.61 4.63
1u8sA02 75.19 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 84 1 88 4.21 4.78
2hiyA02 73.42 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.1260 91 6 79 3.54 4.47
[1]
Displaying entries 1 to 37 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ifxA01
GIRLLYLLVKPAGSDETFRAECLRHYESHDVPGLHKYEVRLVDAIGECWFKDDAAYATYASDIRKAWFEHGKTFIGQLKP
FRTA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ifxA01
GXIRLLYLLVKPAGXSDETFRAECLRHYEXSHDVPGLHKYEVRLVDAIGECWFKDDAAYATYXASDIRKAWFEHGKTFIG
QLKPFRTA
BLAST against CATH

[top]
Domain History Events (51)

Domain assigned by cuff on 14 Feb 2008 16:19

i agree, same superfamily

Domain assignment manual match h by rupa on 10 Sep 2007 15:15

Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.

Homcheck review by rupa on 10 Sep 2007 15:15

Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.

Flow stage update by rupa on 10 Sep 2007 15:15

Excellent ssap score, same fold, unknonw function. Suggest score high enough for homology.

Homcheck allotment by rupa on 10 Sep 2007 11:06

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 10 Sep 2007 11:06

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 08 Sep 2007 04:15

Domain "2ifxA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 08 Sep 2007 04:15

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ifxA01

Flow stage update by auto on 08 Sep 2007 04:02

Retrieved PRC_PFAMCATH results for job ID SID1682298176264992 and results inserted.

Domain scan prc pfamcath by auto on 08 Sep 2007 04:01

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2ifxA01

Update comment by auto on 07 Sep 2007 23:25

PRC_PFAMCATH job SID1682298176264992 is not yet finished.

Prc pfamcath submit by auto on 07 Sep 2007 23:24

The entry "2ifxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 23:24

The entry "2ifxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 22:35

Retrieved SSAP results for job ID SID8519132626240558 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 22:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3252 results for 2ifxA01

Update comment by auto on 05 Sep 2007 19:24

SSAP job SID8519132626240558 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:52

The entry "2ifxA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:52

The entry "2ifxA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 07:11

Retrieved PRC results for job ID SID1176682846301622 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 07:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2ifxA01

Prc cath submit by auto on 05 Sep 2007 03:29

The entry "2ifxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:29

The entry "2ifxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:58

Retrieved HMM(SAM) results for job ID SID4363190977570240 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:57

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2ifxA01

Update comment by auto on 04 Sep 2007 11:39

HMM(SAM) job SID4363190977570240 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:43

The entry "2ifxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:43

The entry "2ifxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:54

Retrieved "2ifxA01" CATHEDRAL results for job ID SID5014922042297312 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:53

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 180 results for 2ifxA01

Flow stage update by auto on 03 Sep 2007 13:50

The entry "2ifxA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 13:50

The entry "2ifxA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:47

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ifxA01.scanlist" for "2ifxA01"

Write scan list by auto on 03 Sep 2007 11:46

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ifxA01.scanlist" for domain "2ifxA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 10:27

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 10:10

No in_process hits for Domain "2ifxA01" ready to be processed

Flow stage update by auto on 01 Sep 2007 10:10

NW result present for Domain "2ifxA01"

Flow stage update by auto on 31 Aug 2007 19:48

All required files are present for Domain "2ifxA01"

Flow stage update by auto on 30 Aug 2007 15:26

Beginning processing for Domain "2ifxA01"

Insertion by cuff on 30 Aug 2007 10:16

nice chopping