Domain assigned by auto on 06 Jan 2009 11:48
Assigning to "3.80.10.10" based on similarity with "2ifgB01"
CATH Domain: 2ifgA01
2ifgA01
PDB 2ifg, Chain A, Domain 1
Segment boundaries for domain 2ifgA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2ifgA01 | 36 | 191 |
| 2ifgA02 | 193 | 282 |
| 2ifgA03 | 283 | 381 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2ifgA01 CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTP RLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASC
Domain History Events (8)
Flow stage update by auto on 06 Jan 2009 11:33
No in_process hits for Domain "2ifgA01" ready to be processed
Update comment by auto on 13 Sep 2008 20:09
Domain "2ifgA01" hits Domain "2ifgB01" (100% over 100%) which is currently in process
Flow stage update by auto on 13 Sep 2008 20:08
Domain "2ifgA01" hits Domain "2ifgB01" (100% over 100%) which is currently in process
Flow stage update by auto on 13 Sep 2008 20:08
NW result present for Domain "2ifgA01"
Flow stage update by auto on 11 Sep 2008 11:06
All required files are present for Domain "2ifgA01"
Flow stage update by auto on 10 Sep 2008 17:44
Beginning processing for Domain "2ifgA01"
Insertion by auto on 10 Sep 2008 14:50
Final ChopClose added based on similarity with "2ifgB"
