CATH Domain: 2id3A01

2id3A01

PDB 2id3, Chain A, Domain 1

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.10	Arc Repressor Mutant, subunit A
1.10.10.60	Homeodomain-like	Gene3D
1.10.10.60.13
1.10.10.60.13.1
1.10.10.60.13.1.1
1.10.10.60.13.1.1.1
1.10.10.60.13.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2id3A01

Domain	Start PDB Residue	Stop PDB Residue
2id3A01	13	61
2id3A02	62	203

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (33 entries)

There are 33 matching structural neighberhood comparisons for CATH ID 1.10.10.60.13.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2fq4A01	93.16	Transcriptional regulator, TetR familyBacillus cereus ATCC 14579	1.10.10.60	47	34	97	1.67	1.71
2id6A01	92.75	Thermotoga maritimaTranscriptional regulator, TetR family	1.10.10.60	46	28	95	2.21	2.31
1zkgA01	92.74	Thermotoga maritimaTranscriptional regulator, TetR family	1.10.10.60	46	28	95	2.15	2.25
1t56A01	91.50	TRANSCRIPTIONAL REGULATORY REPRESSOR PROTEIN (TETR-FAMILY) ETHRMycobacterium tuberculosis	1.10.10.60	46	19	95	1.48	1.55
2ibdA01	89.97	Rhodococcus jostii RHA1Possible transcriptional regulator	1.10.10.60	45	24	91	1.69	1.85
2raeA01	89.78	Rhodococcus jostii RHA1Transcriptional regulator, AcrR family protein	1.10.10.60	43	18	89	1.47	1.65
2hyjA01	89.67	Streptomyces coelicolorPutative tetR-family transcriptional regulator	1.10.10.60	46	19	95	1.79	1.87
3ccyA01	89.47	Bordetella parapertussisPutative TetR-family transcriptional regulator	1.10.10.60	44	25	91	1.92	2.10
3f0cA01	89.36	Cytophaga hutchinsonii ATCC 33406Transcriptional regulator	1.10.10.60	47	25	91	1.85	2.02
1zk8A01	88.82	Transcriptional regulator, TetR familyBacillus cereus ATCC 14579	1.10.10.60	46	17	93	2.42	2.58
1rktA01	88.56	Bacillus subtilisUncharacterized HTH-type transcriptional regulator yfiR	1.10.10.60	52	19	88	2.17	2.45
1t33A01	88.00	Putative transcriptional repressor (TetR/AcrR family)Salmonella enterica subsp. enterica serovar Typhimurium	1.10.10.60	62	17	75	1.33	1.75
3c2bA01	87.88	Agrobacterium tumefaciens str. C58Transcriptional regulator, TetR family	1.10.10.60	51	29	86	1.88	2.18
3bqyA01	85.60	Putative transcriptional regulatorStreptomyces coelicolor	1.10.10.60	48	17	81	2.17	2.67
1gv2A02	84.14	Transcriptional activator MybNucleusEmbryonic digestive tract developmentProtein bindingMus musculus	1.10.10.60	46	17	89	3.28	3.67
2hxoA01	82.43	Streptomyces coelicolorPutative TetR-family transcriptional regulator	1.10.10.60	63	23	68	2.02	2.96
2np3B01	82.17	Streptomyces coelicolorPutative TetR-family regulator	1.10.10.60	60	31	76	2.57	3.35
1mh3A03	81.71	Transcription corepressor activityMeiosis - yeastNucleusRegulation of transcription, mating-type specificMating-type protein A1	1.10.10.60	51	12	84	3.70	4.39
1gdtB03	81.08	Transposon gamma-delta resolvaseEscherichia coli K-12	1.10.10.60	45	15	87	3.33	3.82
1k6yA01	81.00	POL polyproteinHuman immunodeficiency virus 1	1.10.10.200	46	4	82	3.21	3.87
1tc3C00	80.69	Caenorhabditis elegansTransposable element Tc3 transposase	1.10.10.60	51	10	84	4.05	4.80
1b8iB00	79.73	Oenocyte developmentLeg disc proximal/distal pattern formationTranscription factor complexBrain developmentDrosophila melanogaster	1.10.10.60	58	14	77	3.47	4.47
1hcrA00	79.53	Salmonella enterica subsp. enterica serovar TyphimuriumDNA-invertase hin	1.10.10.60	52	19	82	3.56	4.31
1hlvA01	78.94	Centromere protein BMajor centromere autoantigen BHomo sapiensChromosome, centromeric region	1.10.10.60	58	17	68	3.04	4.41
2k9nA02	78.80	MYB24Trichomonas vaginalis	1.10.10.60	54	8	77	3.19	4.10
1w0tA00	77.67	Protein homooligomerizationPositive regulation of mitotic cell cycleTelomere maintenance via telomere shorteningNegative regulation of telomerase activityG2/M transition of mitotic cell cycle	1.10.10.60	52	8	80	3.84	4.75
1irzA00	77.42	Regulation of anthocyanin metabolic processCytokinin mediated signaling pathwayNucleusSequence-specific DNA binding transcription factor activityArabidopsis thaliana	1.10.10.60	64	8	73	3.21	4.37
1sauA02	77.36	Archaeoglobus fulgidusSulfite reductase, desulfoviridin-type subunit gamma (DsvC)	1.10.10.370	70	12	64	2.81	4.37
1a6qA02	75.96	Protein phosphatase 1AWnt receptor signaling pathwayProtein phosphatase 1A (formerly 2C) [EC:3.1.3.16]Positive regulation of transcription, DNA-dependentPositive regulation of I-kappaB kinase/NF-kappaB cascade	1.10.10.430	69	4	56	2.75	4.87
1bl0A01	75.20	Multiple antibiotic resistance protein marAAraC family transcriptional regulator, multiple antibiotic resistance protein MarAEscherichia coli K-12	1.10.10.60	56	14	75	3.60	4.80
2qwtA00	68.89	Transcriptional regulator, TetR familyMycobacterium vanbaalenii PYR-1	1.10.357.10	167	48	28	1.22	4.33
3bniB00	67.60	Streptomyces coelicolorPutative TetR-family transcriptional regulator	1.10.357.10	171	31	25	1.05	4.18
3colB00	65.45	Transcription regulator (Putative)Lactobacillus plantarum	1.10.357.10	170	17	24	1.22	4.94

[top]
Domain ATOM Sequence

>pdb|2id3A01
GGRTARIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGT

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2id3A01
GGRTARIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGT

BLAST against CATH

[top]
Domain History Events (62)

Domain assigned by cuff on 24 Jul 2008 17:40

same superfamily

Homcheck comment by cuff on 25 Jun 2008 18:48

same superfam

Homcheck review by yan on 16 Jun 2008 16:17

same super family

Flow stage update by yan on 16 Jun 2008 16:17

same super family

Domain assignment manual match h by yan on 16 Jun 2008 16:16

same family in Scop, very high level of overlapping, same function

Homcheck allotment by yan on 16 Jun 2008 16:09

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by yan on 16 Jun 2008 16:09

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 May 2008 17:49

Calculated SCOP results for 2id3A01 and inserted them into the database.

Domain scan scop cath by auto on 02 May 2008 17:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 256 results for 2id3A01

Flow stage update by auto on 24 Feb 2008 09:00

Retrieved PRC_PFAMCATH results for job ID SID5522689174474064 and results inserted.

Domain scan prc pfamcath by auto on 24 Feb 2008 08:59

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 166 results for 2id3A01

Update comment by auto on 24 Feb 2008 00:10

PRC_PFAMCATH job SID5522689174474064 is not yet finished.

Flow stage update by auto on 24 Feb 2008 00:08

The entry "2id3A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 24 Feb 2008 00:08

The entry "2id3A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 23 Feb 2008 23:45

Retrieved SSAP results for job ID SID2793704589544672 and results inserted.

Domain scan ssap cath by auto on 23 Feb 2008 23:43

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2063 results for 2id3A01

Update comment by auto on 23 Feb 2008 12:37

SSAP job SID2793704589544672 is not yet finished.

Flow stage update by auto on 23 Feb 2008 12:35

The entry "2id3A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Feb 2008 12:35

The entry "2id3A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Feb 2008 12:34

Retrieved PRC results for job ID SID9689912153452716 and inserted them into the database.

Domain scan prc cath by auto on 23 Feb 2008 12:34

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 34 results for 2id3A01

Update comment by auto on 22 Feb 2008 21:34

PRC job SID9689912153452716 is not yet finished.

Prc cath submit by auto on 22 Feb 2008 21:34

The entry "2id3A01" has been submitted to the PRC webservice.

Flow stage update by auto on 22 Feb 2008 21:34

The entry "2id3A01" has been submitted to the PRC webservice.

Flow stage update by auto on 22 Feb 2008 21:34

Retrieved HMM(SAM) results for job ID SID7530812267916603 and inserted them into the database.

Domain scan sam cath by auto on 22 Feb 2008 21:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 27 results for 2id3A01