CATH Domain: 2icsA01 XML data for domain: 2icsA01

Molscript image for 2icsA01
2icsA01
PDB coordinates for domain 2icsA01

PDB 2ics, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.16
2.30.40.10.16.1
2.30.40.10.16.1.1
2.30.40.10.16.1.1.1
2.30.40.10.16.1.1.1.1

[top]
Segment boundaries for domain 2icsA01

Chopping figure for domain 2icsA01
DomainStart PDB ResidueStop PDB Residue
2icsA01 4 54
2icsA01 322 371
2icsA02 55 321

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.30.40.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkrA01 86.60 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 28 76 1.55 2.04
2qs8A01 85.24 2.30.40.10 99 19 87 3.60 4.14
3feqA01 85.03 2.30.40.10 105 14 80 3.14 3.88
3be7A01 83.66 2.30.40.10 95 16 84 3.75 4.46
1o12A01 81.82 Amino sugar and nucleotide sugar metabolismThermotoga maritimaN-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 72 18 65 2.82 4.34
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2icsA01
DYDLLIKNGQTVNGPVEIAIKEKKIAAVAATISGSAKETIHLEPGTYVSATLEIGKDADLTIFTIQAEEKTLTDSNGLTR
VAKEQIRPIKTIIGGQIYDN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2icsA01
XSLDYDLLIKNGQTVNGXPVEIAIKEKKIAAVAATISGSAKETIHLEPGTYVSATLEIGKDADLTIFTIQAEEKTLTDSN
GLTRVAKEQIRPIKTIIGGQIYDNEGHHHHHH
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 12 Feb 2008 16:45

same superfamily

Domain assignment manual match h by cuff on 12 Feb 2008 16:44

all top hits are for superfamily 2.30.40.10. They have a similar function to the query and structural comparison scores are all good

Domain assignment manual match t by tronnberg on 10 Sep 2007 11:02

SSAP: 80.98 OV: 75 SEQ: 23. Similar structure and linkage. Functionally different. Most of the suggested matches are in the 2.30.40 topology.

Homcheck review by tronnberg on 10 Sep 2007 11:02

SSAP: 80.98 OV: 75 SEQ: 23. Similar structure and linkage. Functionally different. Most of the suggested matches are in the 2.30.40 topology.

Flow stage update by tronnberg on 10 Sep 2007 11:02

SSAP: 80.98 OV: 75 SEQ: 23. Similar structure and linkage. Functionally different. Most of the suggested matches are in the 2.30.40 topology.

Homcheck allotment by tronnberg on 10 Sep 2007 10:55

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Sep 2007 10:55

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 19:58

Domain "2icsA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 19:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2icsA01

Flow stage update by auto on 07 Sep 2007 19:41

Retrieved PRC_PFAMCATH results for job ID SID2333853043068960 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 19:40

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2icsA01

Flow stage update by auto on 07 Sep 2007 19:23

The entry "2icsA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Sep 2007 19:23

The entry "2icsA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 18:29

Retrieved SSAP results for job ID SID0149891465599080 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 18:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1215 results for 2icsA01

Update comment by auto on 05 Sep 2007 19:24

SSAP job SID0149891465599080 is not yet finished.

Flow stage update by auto on 05 Sep 2007 15:51

The entry "2icsA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 15:51

The entry "2icsA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 07:05

Retrieved PRC results for job ID SID8456437980988320 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 07:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2icsA01

Prc cath submit by auto on 05 Sep 2007 03:28

The entry "2icsA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:28

The entry "2icsA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:51

Retrieved HMM(SAM) results for job ID SID2983992587014032 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:50

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2icsA01

Update comment by auto on 04 Sep 2007 11:38

HMM(SAM) job SID2983992587014032 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:42

The entry "2icsA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:42

The entry "2icsA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:47

Retrieved "2icsA01" CATHEDRAL results for job ID SID2491737604080912 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:46

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 39 results for 2icsA01

Cathedral cath submit by auto on 03 Sep 2007 13:49

The entry "2icsA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:49

The entry "2icsA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:46

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2icsA01.scanlist" for "2icsA01"

Write scan list by auto on 03 Sep 2007 11:46

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2icsA01.scanlist" for domain "2icsA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:57

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2icsA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2icsA01"

Flow stage update by auto on 23 Aug 2007 10:08

All required files are present for Domain "2icsA01"

Flow stage update by auto on 22 Aug 2007 18:23

Beginning processing for Domain "2icsA01"

Insertion by cuff on 22 Aug 2007 17:01

nice chopping