CATH Domain: 2ib0A01 XML data for domain: 2ib0A01

Molscript image for 2ib0A01
2ib0A01
PDB coordinates for domain 2ib0A01

PDB 2ib0, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.20
1.20.1260.10.20.1
1.20.1260.10.20.1.1
1.20.1260.10.20.1.1.1
1.20.1260.10.20.1.1.1.1

[top]
Segment boundaries for domain 2ib0A01

Chopping figure for domain 2ib0A01
DomainStart PDB ResidueStop PDB Residue
2ib0A01 17 151

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2yw6B00 87.82 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 11 90 2.76 3.07
2fjcB00 87.09 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 14 84 2.38 2.81
1z0pA00 76.15 Streptococcus pyogenes serotype M1Putative uncharacterized protein 1.20.58.90 73 4 43 1.99 4.55
1bsmA01 75.06 Superoxide dismutase [Mn/Fe]Propionibacterium freudenreichii subsp. shermanii 1.10.287.990 64 6 43 1.66 3.80
1jm0A00 74.97 1.20.5.420 48 16 35 1.08 3.04
3csxA00 74.49 Cyanothece sp. ATCC 51142DUF683-containing protein 1.10.287.660 61 13 40 1.65 4.12
1nkdA00 73.99 Regulatory protein ropEscherichia coli 1.10.287.230 59 3 39 1.70 4.33
2rklB00 72.60 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 6 34 1.27 3.65
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ib0A01
SEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSA
ADAARLAVRMENDGATAWRAVVEHAETADDRVFASTALTESAVMATRWNRVLGAW
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ib0A01
SEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSA
ADAARLAVRMENDGATAWRAVVEHAETADDRVFASTALTESAVMATRWNRVLGAW
BLAST against CATH

[top]
Domain History Events (137)

Domain assigned by cuff on 12 Feb 2008 13:43

superfamily match

Domain assignment manual match h by cuff on 12 Feb 2008 13:42

all top hits are in family 1.20.1260.10. good structural comparison results

Domain assignment manual match t by tronnberg on 03 Sep 2007 10:54

SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.

Homcheck review by tronnberg on 03 Sep 2007 10:54

SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.

Flow stage update by tronnberg on 03 Sep 2007 10:54

SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.

Homcheck allotment by tronnberg on 03 Sep 2007 10:51

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 03 Sep 2007 10:51

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 02 Sep 2007 05:35

Domain "2ib0A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 02 Sep 2007 05:34

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ib0A01

Flow stage update by auto on 02 Sep 2007 03:40

Retrieved PRC_PFAMCATH results for job ID SID3420717501123392 and results inserted.

Domain scan prc pfamcath by auto on 02 Sep 2007 03:39

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2ib0A01

Update comment by auto on 01 Sep 2007 22:55

PRC_PFAMCATH job SID3420717501123392 is not yet finished.

Prc pfamcath submit by auto on 01 Sep 2007 22:51

The entry "2ib0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 01 Sep 2007 22:51

The entry "2ib0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 01 Sep 2007 22:20

Retrieved SSAP results for job ID SID6668266317309232 and results inserted.

Domain scan ssap cath by auto on 01 Sep 2007 22:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2436 results for 2ib0A01

Update comment by auto on 31 Aug 2007 20:20

SSAP job SID6668266317309232 is not yet finished.

Ssap cath submit by auto on 31 Aug 2007 20:10

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 31 Aug 2007 20:10

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 30 Aug 2007 16:50

Giving up on SSAP job SID4393315869966872 because submission time of Tue Aug 28 14:53:41 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:50:34 2007).

Update comment by auto on 28 Aug 2007 15:01

SSAP job SID4393315869966872 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:53

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:53

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:19

Giving up on SSAP job SID1768221770211584 because submission time of Sun Aug 26 09:12:21 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:19:24 2007).

Update comment by auto on 26 Aug 2007 09:21

SSAP job SID1768221770211584 is not yet finished.

Flow stage update by auto on 26 Aug 2007 09:12

The entry "2ib0A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 26 Aug 2007 09:12

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 02:57

Giving up on SSAP job SID7760324085466368 because submission time of Thu Aug 23 22:35:00 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:57:22 2007).

Update comment by auto on 23 Aug 2007 22:45

SSAP job SID7760324085466368 is not yet finished.

Flow stage update by auto on 23 Aug 2007 22:35

The entry "2ib0A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Aug 2007 22:35

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:37

Giving up on SSAP job SID6074039125440804 because submission time of Tue Aug 21 10:56:02 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:37:40 2007).

Update comment by auto on 21 Aug 2007 11:37

SSAP job SID6074039125440804 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:56

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:56

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:17

Giving up on SSAP job SID2178044275058024 because submission time of Sun Aug 19 07:34:42 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:17:05 2007).

Update comment by auto on 19 Aug 2007 08:27

SSAP job SID2178044275058024 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:34

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:34

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:35

Giving up on SSAP job SID8143794398299616 because submission time of Thu Aug 16 23:27:00 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:35:47 2007).

Update comment by auto on 17 Aug 2007 00:36

SSAP job SID8143794398299616 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:27

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:27

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:35

Giving up on SSAP job SID7347563424222976 because submission time of Tue Aug 14 09:04:02 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:35:54 2007).

Update comment by auto on 14 Aug 2007 10:35

SSAP job SID7347563424222976 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:04

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:04

The entry "2ib0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:18

Retrieved PRC results for job ID SID1068589508954824 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:18

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2ib0A01

Prc cath submit by auto on 13 Aug 2007 10:34

The entry "2ib0A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 10:34

The entry "2ib0A01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 07:53

Retrieved HMM(SAM) results for job ID SID1567871113807848 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 07:53

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2ib0A01

Update comment by auto on 12 Aug 2007 13:07

HMM(SAM) job SID1567871113807848 is not yet finished.

Flow stage update by auto on 12 Aug 2007 11:51

The entry "2ib0A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 11:51

The entry "2ib0A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 03:47

Retrieved "2ib0A01" CATHEDRAL results for job ID SID7116804877465632 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 03:46

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 130 results for 2ib0A01

Update comment by auto on 11 Aug 2007 05:53

"2ib0A01" CATHEDRAL job SID7116804877465632 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:20

The entry "2ib0A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:20

The entry "2ib0A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:24

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ib0A01.scanlist" for "2ib0A01"

Write scan list by auto on 11 Aug 2007 02:24

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ib0A01.scanlist" for domain "2ib0A01"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:46

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:32

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:13

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:58

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:57

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:44

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:51

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:34

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:42

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:41

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:04

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:50

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:56

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:45

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:32

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:14

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:43

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:55

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:49

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:37

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:49

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:43

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:21

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:16

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:14

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:04

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:21

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:12

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:50

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:06

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:09

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:09

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:59

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:08

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:56

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:52

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:48

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:00

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:02

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:01

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:46

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:30

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:23

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:04

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:03

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:02

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:44

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:33

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:05

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:56

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:58

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 03:02

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:42

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 19:01

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:52

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:09

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:26

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:29

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:32

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:54

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:28

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:05

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:32

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:36

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:35

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Jul 2007 06:59

No satisfactory AssignClose result found.

Flow stage update by auto on 29 Jul 2007 06:55

No in_process hits for Domain "2ib0A01" ready to be processed

Flow stage update by auto on 29 Jul 2007 06:55

NW result present for Domain "2ib0A01"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2ib0A01"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2ib0A01"

Insertion by cuff on 10 Jul 2007 10:52

nice chopping