Domain assigned by cuff on 12 Feb 2008 13:43
superfamily match
| CATH Code | Level Description | Links |
|---|---|---|
1
| Mainly Alpha | |
1.20
| Up-down Bundle | |
1.20.1260
| Ferritin; | |
1.20.1260.10
| Gene3D | |
1.20.1260.10.20
| ||
1.20.1260.10.20.1
| ||
1.20.1260.10.20.1.1
| ||
1.20.1260.10.20.1.1.1
| ||
1.20.1260.10.20.1.1.1.1
|
There are 8 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.20.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2yw6B00 | 87.82 | 1.20.1260.10 | 150 | 11 | 90 | 2.76 | 3.07 | |
![]() |
2fjcB00 | 87.09 | 1.20.1260.10 | 156 | 14 | 84 | 2.38 | 2.81 | |
![]() |
1z0pA00 | 76.15 | 1.20.58.90 | 73 | 4 | 43 | 1.99 | 4.55 | |
![]() |
1bsmA01 | 75.06 | 1.10.287.990 | 64 | 6 | 43 | 1.66 | 3.80 | |
![]() |
1jm0A00 | 74.97 | 1.20.5.420 | 48 | 16 | 35 | 1.08 | 3.04 | |
![]() |
3csxA00 | 74.49 | 1.10.287.660 | 61 | 13 | 40 | 1.65 | 4.12 | |
![]() |
1nkdA00 | 73.99 | 1.10.287.230 | 59 | 3 | 39 | 1.70 | 4.33 | |
![]() |
2rklB00 | 72.60 | 1.20.5.420 | 50 | 6 | 34 | 1.27 | 3.65 |
>pdb|2ib0A01 SEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSA ADAARLAVRMENDGATAWRAVVEHAETADDRVFASTALTESAVMATRWNRVLGAW
superfamily match
all top hits are in family 1.20.1260.10. good structural comparison results
SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.
SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.
SSAP: 88.67 OV: 91 SEQ: 10. Very similar linkages.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2ib0A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ib0A01
Retrieved PRC_PFAMCATH results for job ID SID3420717501123392 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2ib0A01
PRC_PFAMCATH job SID3420717501123392 is not yet finished.
The entry "2ib0A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2ib0A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID6668266317309232 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2436 results for 2ib0A01
SSAP job SID6668266317309232 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4393315869966872 because submission time of Tue Aug 28 14:53:41 2007 is more than 172800 seconds older than current time (Thu Aug 30 16:50:34 2007).
SSAP job SID4393315869966872 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID1768221770211584 because submission time of Sun Aug 26 09:12:21 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:19:24 2007).
SSAP job SID1768221770211584 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7760324085466368 because submission time of Thu Aug 23 22:35:00 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:57:22 2007).
SSAP job SID7760324085466368 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6074039125440804 because submission time of Tue Aug 21 10:56:02 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:37:40 2007).
SSAP job SID6074039125440804 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID2178044275058024 because submission time of Sun Aug 19 07:34:42 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:17:05 2007).
SSAP job SID2178044275058024 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8143794398299616 because submission time of Thu Aug 16 23:27:00 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:35:47 2007).
SSAP job SID8143794398299616 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7347563424222976 because submission time of Tue Aug 14 09:04:02 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:35:54 2007).
SSAP job SID7347563424222976 is not yet finished.
The entry "2ib0A01" has been submitted to the SSAP webservice.
The entry "2ib0A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID1068589508954824 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2ib0A01
The entry "2ib0A01" has been submitted to the PRC webservice.
The entry "2ib0A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID1567871113807848 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2ib0A01
HMM(SAM) job SID1567871113807848 is not yet finished.
The entry "2ib0A01" has been submitted to the HMM (SAM) webservice.
The entry "2ib0A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2ib0A01" CATHEDRAL results for job ID SID7116804877465632 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 130 results for 2ib0A01
"2ib0A01" CATHEDRAL job SID7116804877465632 is not yet finished.
The entry "2ib0A01" has been submitted to the CATHEDRAL webservice.
The entry "2ib0A01" has been submitted to the CATHEDRAL webservice.
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ib0A01.scanlist" for "2ib0A01"
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ib0A01.scanlist" for domain "2ib0A01"
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2ib0A01" ready to be processed
NW result present for Domain "2ib0A01"
All required files are present for Domain "2ib0A01"
Beginning processing for Domain "2ib0A01"
nice chopping