CATH Domain: 2iafA00 XML data for domain: 2iafA00

Molscript image for 2iafA00
2iafA00
PDB coordinates for domain 2iafA00

PDB 2iaf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1330 60s Ribosomal Protein L30; Chain: A;
3.30.1330.90 D-3-phosphoglycerate dehydrogenase; domain 3 Gene3D
3.30.1330.90.1
3.30.1330.90.1.1
3.30.1330.90.1.1.1
3.30.1330.90.1.1.1.1
3.30.1330.90.1.1.1.1.1

[top]
Segment boundaries for domain 2iafA00

Chopping figure for domain 2iafA00
DomainStart PDB ResidueStop PDB Residue
2iafA00 4 148

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2iafA00
SSHTVGPLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESIPRHEILDSNLLNLAGKKE
IPFHEATDFLFLQKELLPKHSNGRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2iafA00
IGIGPSSSHTVGPXLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPETVDPASXIPRXHE
ILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGXRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
BLAST against CATH

[top]
Domain History Events (82)

Domain assigned by cuff on 08 Mar 2008 17:17

same superfamily

Domain assignment manual match h by cuff on 08 Mar 2008 17:14

nice structural match, same superfamily in scop

Homcheck comment by rupa on 11 Sep 2007 12:29

After further review this still seems like the most appropriate choice.

Domain assignment manual match t by rupa on 21 Aug 2007 10:47

High cathedral and ssap scores, same folding, different functions.

Homcheck review by rupa on 21 Aug 2007 10:47

High cathedral and ssap scores, same folding, different functions.

Flow stage update by rupa on 21 Aug 2007 10:47

High cathedral and ssap scores, same folding, different functions.

Homcheck allotment by rupa on 21 Aug 2007 10:45

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 21 Aug 2007 10:45

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 18 Jul 2007 09:33

Domain "2iafA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 18 Jul 2007 09:33

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2iafA00

Flow stage update by auto on 18 Jul 2007 08:55

Retrieved PRC_PFAMCATH results for job ID SID0112826662628736 and chopping inserted.

Domain scan prc pfamcath by auto on 18 Jul 2007 08:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2iafA00

Update comment by auto on 18 Jul 2007 04:25

PRC_PFAMCATH job SID0112826662628736 is not yet finished.

Prc pfamcath submit by auto on 18 Jul 2007 03:55

The entry "2iafA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Jul 2007 03:55

The entry "2iafA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Jul 2007 03:45

Retrieved SSAP results for job ID SID6531703332798400 and chopping inserted.

Domain scan ssap cath by auto on 18 Jul 2007 03:41

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1371 results for 2iafA00

Update comment by auto on 16 Jul 2007 19:56

SSAP job SID6531703332798400 is not yet finished.

Flow stage update by auto on 16 Jul 2007 19:45

The entry "2iafA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Jul 2007 19:45

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 16:59

Giving up on SSAP job SID6851788682715064 because submission time of Sat Jul 14 13:28:55 2007 is more than 172800 seconds older than current time (Mon Jul 16 16:59:15 2007).

Update comment by auto on 14 Jul 2007 13:44

SSAP job SID6851788682715064 is not yet finished.

Ssap cath submit by auto on 14 Jul 2007 13:28

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 13:28

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 07:26

Giving up on SSAP job SID8544598387764544 because submission time of Thu Jul 12 00:26:00 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:26:58 2007).

Update comment by auto on 12 Jul 2007 01:02

SSAP job SID8544598387764544 is not yet finished.

Flow stage update by auto on 12 Jul 2007 00:26

The entry "2iafA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 12 Jul 2007 00:26

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 11 Jul 2007 22:59

Giving up on SSAP job SID0634564917857584 because submission time of Mon Jul 9 22:30:46 2007 is more than 172800 seconds older than current time (Wed Jul 11 22:59:52 2007).

Update comment by auto on 09 Jul 2007 23:07

SSAP job SID0634564917857584 is not yet finished.

Ssap cath submit by auto on 09 Jul 2007 22:30

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 22:30

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 20:43

Giving up on SSAP job SID4658157256644279 because submission time of Sat Jul 7 16:10:59 2007 is more than 172800 seconds older than current time (Mon Jul 9 20:43:28 2007).

Update comment by auto on 07 Jul 2007 16:52

SSAP job SID4658157256644279 is not yet finished.

Ssap cath submit by auto on 07 Jul 2007 16:10

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 16:10

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 15:30

Giving up on SSAP job SID8094272995344376 because submission time of Thu Jul 5 15:28:34 2007 is more than 172800 seconds older than current time (Sat Jul 7 15:30:28 2007).

Update comment by auto on 05 Jul 2007 16:39

SSAP job SID8094272995344376 is not yet finished.

Flow stage update by auto on 05 Jul 2007 15:28

The entry "2iafA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Jul 2007 15:28

The entry "2iafA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 15:08

Retrieved PRC results for job ID SID1699956363545280 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 15:07

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2iafA00

Update comment by auto on 05 Jul 2007 10:40

PRC job SID1699956363545280 is not yet finished.

Prc cath submit by auto on 05 Jul 2007 06:39

The entry "2iafA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:39

The entry "2iafA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:27

Retrieved HMM(SAM) results for job ID SID2802768254310512 and inserted them into the database.

Domain scan sam cath by auto on 05 Jul 2007 06:26

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2iafA00

Update comment by auto on 04 Jul 2007 00:52

HMM(SAM) job SID2802768254310512 is not yet finished.

Sam cath submit by auto on 03 Jul 2007 23:07

The entry "2iafA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 23:07

The entry "2iafA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 22:30

Retrieved "2iafA00" CATHEDRAL results for job ID SID8281685182703512 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 22:30

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 518 results for 2iafA00

Update comment by auto on 03 Jul 2007 09:26

"2iafA00" CATHEDRAL job SID8281685182703512 is not yet finished.

Cathedral cath submit by auto on 03 Jul 2007 08:11

The entry "2iafA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 08:11

The entry "2iafA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 07:17

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2iafA00.scanlist" for "2iafA00"

Write scan list by auto on 03 Jul 2007 07:17

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2iafA00.scanlist" for domain "2iafA00"

Update comment by auto on 03 Jul 2007 02:13

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:06

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:23

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:04

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:06

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:06

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:02

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:10

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:08

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:04

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:03

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:08

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:02

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:11

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:07

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:05

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:08

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:09

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:29

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:26

No satisfactory AssignClose result found.

Flow stage update by auto on 25 Jun 2007 18:02

No in_process hits for Domain "2iafA00" ready to be processed

Flow stage update by auto on 25 Jun 2007 18:02

NW result present for Domain "2iafA00"

Flow stage update by auto on 25 Jun 2007 18:02

All required files are present for Domain "2iafA00"

Flow stage update by auto on 25 Jun 2007 18:02

Beginning processing for Domain "2iafA00"

Insertion by cuff on 30 May 2007 15:25

chopping good to go