CATH Domain: 2ia7A00

2ia7A00

PDB 2ia7, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.10	Roll
3.10.450	Nuclear Transport Factor 2; Chain: A,
3.10.450.40		Gene3D
3.10.450.40.4
3.10.450.40.4.1
3.10.450.40.4.1.1
3.10.450.40.4.1.1.1
3.10.450.40.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2ia7A00

Domain	Start PDB Residue	Stop PDB Residue
2ia7A00	23	133

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|2ia7A00
AVLSSAEEDIAESIRIILGTARGERVRPDFGCGIHDRVFSVINTTTLGLIENEVKEALILWEPRIELLSVTASPREAAEG
RLLIDIEYRVRSTNTRFNLVYPFYLKESA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2ia7A00
GXTKAREFLGTGWKFPVAAGADGAXVLSSAEEDIAESIRIILGTARGERVXRPDFGCGIHDRVFSVINTTTLGLIENEVK
EALILWEPRIELLSVTASPREAAEGRLLIDIEYRVRSTNTRFNLVYPFYLKESA

BLAST against CATH

[top]
Domain History Events (113)

Domain assigned by cuff on 13 Feb 2008 16:39

i agree, same superfamily

Domain assignment manual match h by rupa on 11 Sep 2007 12:23

After further review, the score might be just high enough for some homology. The superposition fit is very good.

Domain assignment manual match t by rupa on 21 Aug 2007 10:43

Good cathedral and ssap score, same folding, unknown function.

Homcheck review by rupa on 21 Aug 2007 10:43

Good cathedral and ssap score, same folding, unknown function.

Flow stage update by rupa on 21 Aug 2007 10:43

Good cathedral and ssap score, same folding, unknown function.

Homcheck allotment by rupa on 21 Aug 2007 10:40

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 21 Aug 2007 10:40

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 20 Aug 2007 12:18

Domain "2ia7A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 20 Aug 2007 12:17

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ia7A00

Flow stage update by auto on 19 Aug 2007 15:34

Retrieved PRC_PFAMCATH results for job ID SID7139229679012370 and chopping inserted.

Domain scan prc pfamcath by auto on 19 Aug 2007 15:34

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2ia7A00

Update comment by auto on 18 Aug 2007 04:11

PRC_PFAMCATH job SID7139229679012370 is not yet finished.

Prc pfamcath submit by auto on 18 Aug 2007 04:04

The entry "2ia7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Aug 2007 04:04

The entry "2ia7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Aug 2007 02:55

Retrieved SSAP results for job ID SID7478868592352672 and chopping inserted.

Domain scan ssap cath by auto on 18 Aug 2007 02:50

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3226 results for 2ia7A00

Update comment by auto on 16 Aug 2007 23:41

SSAP job SID7478868592352672 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 22:36

The entry "2ia7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 22:36

The entry "2ia7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:30

Giving up on SSAP job SID4356628723333728 because submission time of Tue Aug 14 09:03:45 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:30:46 2007).

Update comment by auto on 14 Aug 2007 10:35

SSAP job SID4356628723333728 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 09:03

The entry "2ia7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 09:03

The entry "2ia7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 06:17

Retrieved PRC results for job ID SID6829246307985168 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 06:16

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2ia7A00

Flow stage update by auto on 13 Aug 2007 10:33

The entry "2ia7A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:33

The entry "2ia7A00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 07:52

Retrieved HMM(SAM) results for job ID SID0354832435934648 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 07:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2ia7A00

Update comment by auto on 12 Aug 2007 13:07

HMM(SAM) job SID0354832435934648 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:50

The entry "2ia7A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:50

The entry "2ia7A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 03:45

Retrieved "2ia7A00" CATHEDRAL results for job ID SID7500708278149760 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 03:44

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 296 results for 2ia7A00

Update comment by auto on 11 Aug 2007 05:53

"2ia7A00" CATHEDRAL job SID7500708278149760 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:20

The entry "2ia7A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:20

The entry "2ia7A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:23

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ia7A00.scanlist" for "2ia7A00"

Write scan list by auto on 11 Aug 2007 02:23

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ia7A00.scanlist" for domain "2ia7A00"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:45

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:46

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:32

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:13

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:58

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:57

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:44

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:51

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:34

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:42

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:41

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:04

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:50

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:56

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:45

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:32

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:14

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:43

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:55

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:49

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:36

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:49

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:43

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:21

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:16

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:14

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:04

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:21

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:12

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:50

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:06

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:09

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:09

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:59

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:08

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:56

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:52

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:48

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 11:00

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:02

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 03:01

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:46

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:30

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:23

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:04

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:03

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:02

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:44

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:33

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:05

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:56

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:58

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 03:02

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:42

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 19:01

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:52

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:09

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:26

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:29

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:32

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:54

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:28

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:05

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:32

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:36

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:35

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Jul 2007 06:59

No satisfactory AssignClose result found.

Flow stage update by auto on 29 Jul 2007 06:55

No in_process hits for Domain "2ia7A00" ready to be processed

Flow stage update by auto on 29 Jul 2007 06:55

NW result present for Domain "2ia7A00"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2ia7A00"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2ia7A00"

Insertion by cuff on 10 Jul 2007 10:52

nice chopping

CATH Domain: 2ia7A00

PDB 2ia7, Chain A, Domain 0

[top] Segment boundaries for domain 2ia7A00

What is a Structural Neighbour?

Structural Neighbourhood (0 entries)

[top] Domain ATOM Sequence

[top] Domain COMBS Sequence

[top] Domain History Events (113)

Domain assigned by cuff on 13 Feb 2008 16:39

Domain assignment manual match h by rupa on 11 Sep 2007 12:23

Domain assignment manual match t by rupa on 21 Aug 2007 10:43

Homcheck review by rupa on 21 Aug 2007 10:43

Flow stage update by rupa on 21 Aug 2007 10:43

Homcheck allotment by rupa on 21 Aug 2007 10:40

Flow stage update by rupa on 21 Aug 2007 10:40

Flow stage update by auto on 20 Aug 2007 12:18

Domain scan scop cath by auto on 20 Aug 2007 12:17

Flow stage update by auto on 19 Aug 2007 15:34

Domain scan prc pfamcath by auto on 19 Aug 2007 15:34

Update comment by auto on 18 Aug 2007 04:11

Prc pfamcath submit by auto on 18 Aug 2007 04:04

Flow stage update by auto on 18 Aug 2007 04:04

Flow stage update by auto on 18 Aug 2007 02:55

Domain scan ssap cath by auto on 18 Aug 2007 02:50

Update comment by auto on 16 Aug 2007 23:41

Ssap cath submit by auto on 16 Aug 2007 22:36

Flow stage update by auto on 16 Aug 2007 22:36

Flow stage update by auto on 16 Aug 2007 17:30

Update comment by auto on 14 Aug 2007 10:35

Ssap cath submit by auto on 14 Aug 2007 09:03

Flow stage update by auto on 14 Aug 2007 09:03

Flow stage update by auto on 14 Aug 2007 06:17

Domain scan prc cath by auto on 14 Aug 2007 06:16

Flow stage update by auto on 13 Aug 2007 10:33

Prc cath submit by auto on 13 Aug 2007 10:33

Flow stage update by auto on 13 Aug 2007 07:52

Domain scan sam cath by auto on 13 Aug 2007 07:51

Update comment by auto on 12 Aug 2007 13:07

Sam cath submit by auto on 12 Aug 2007 11:50

Flow stage update by auto on 12 Aug 2007 11:50

Flow stage update by auto on 12 Aug 2007 03:45

Domain scan cathedral cath by auto on 12 Aug 2007 03:44

Update comment by auto on 11 Aug 2007 05:53

Flow stage update by auto on 11 Aug 2007 04:20

Cathedral cath submit by auto on 11 Aug 2007 04:20

Flow stage update by auto on 11 Aug 2007 02:23

Write scan list by auto on 11 Aug 2007 02:23

Update comment by auto on 10 Aug 2007 14:32

Update comment by auto on 10 Aug 2007 10:31

Update comment by auto on 10 Aug 2007 06:45

Update comment by auto on 10 Aug 2007 02:46

Update comment by auto on 09 Aug 2007 22:32

Update comment by auto on 09 Aug 2007 19:13

Update comment by auto on 09 Aug 2007 14:58

Update comment by auto on 09 Aug 2007 10:57

Update comment by auto on 09 Aug 2007 06:44

Update comment by auto on 09 Aug 2007 02:51

Update comment by auto on 08 Aug 2007 22:34

Update comment by auto on 08 Aug 2007 18:42

Update comment by auto on 08 Aug 2007 14:41

Update comment by auto on 08 Aug 2007 11:04

Update comment by auto on 08 Aug 2007 06:50

Update comment by auto on 08 Aug 2007 02:56

Update comment by auto on 07 Aug 2007 22:45

Update comment by auto on 07 Aug 2007 19:32

Update comment by auto on 07 Aug 2007 15:14

Update comment by auto on 07 Aug 2007 10:43

Update comment by auto on 07 Aug 2007 06:55

Update comment by auto on 07 Aug 2007 02:49

Update comment by auto on 06 Aug 2007 22:36

Update comment by auto on 06 Aug 2007 18:49

Update comment by auto on 06 Aug 2007 14:43

Update comment by auto on 06 Aug 2007 11:21

Update comment by auto on 06 Aug 2007 09:16

Update comment by auto on 06 Aug 2007 02:14

Update comment by auto on 05 Aug 2007 19:04

Update comment by auto on 05 Aug 2007 07:21

Update comment by auto on 05 Aug 2007 03:12

Update comment by auto on 04 Aug 2007 22:50

Update comment by auto on 04 Aug 2007 19:06

[top]
Segment boundaries for domain 2ia7A00

[top]
Domain ATOM Sequence

[top]
Domain COMBS Sequence

[top]
Domain History Events (113)