CATH Domain: 2ia2A02 XML data for domain: 2ia2A02

Molscript image for 2ia2A02
2ia2A02
PDB coordinates for domain 2ia2A02

PDB 2ia2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.12
3.30.450.40.12.1
3.30.450.40.12.1.1
3.30.450.40.12.1.1.1
3.30.450.40.12.1.1.1.1

[top]
Segment boundaries for domain 2ia2A02

Chopping figure for domain 2ia2A02
DomainStart PDB ResidueStop PDB Residue
2ia2A01 16 83
2ia2A02 84 265

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.450.40.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d3oA00 84.90 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 10 92 3.71 4.02
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ia2A02
YSYLSSLSLPEVAQPHLEKLSHKVHESSSVSILDGADIVYVARVPVSRITVGITIGTRLPAYATSGRVLLAGLPDDELDA
YLEKLDIQRLTERTITARDELKAAILAVRADGICVLDQELEAGLRSAAPIRGASGLTVAAVNISTPAARYSLEDLHSDLI
PSLRVTATDIEQDLATVNR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ia2A02
YSYLSSLSLPEVAQPHLEKLSHKVHESSSVSILDGADIVYVARVPVSRIXTVGITIGTRLPAYATSXGRVLLAGLPDDEL
DAYLEKLDIQRLTERTITARDELKAAILAVRADGICVLDQELEAGLRSXAAPIRGASGLTVAAVNISTPAARYSLEDLHS
DLIPSLRVTATDIEQDLATVNR
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 12 Feb 2008 14:22

Assigning to "3.30.450.40" based on similarity with "2ia2D02"

Flow stage update by auto on 12 Feb 2008 14:20

No in_process hits for Domain "2ia2A02" ready to be processed

Update comment by auto on 12 Feb 2008 14:18

Domain "2ia2A02" hits Domain "2ia2D02" (98.3516483516484% over 96.2962962962963%) which is currently in process

Update comment by auto on 12 Feb 2008 14:15

Domain "2ia2A02" hits Domain "2g7uB02" (38.4615384615385% over 96.2765957446808%) which is currently in process

Update comment by auto on 12 Feb 2008 14:13

Domain "2ia2A02" hits Domain "2g7uC02" (38.7640449438202% over 97.8021978021978%) which is currently in process

Update comment by auto on 12 Feb 2008 14:03

Domain "2ia2A02" hits Domain "2g7uA02" (38.7640449438202% over 97.8021978021978%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2ia2A02" hits Domain "2g7uD02" (38.4615384615385% over 96.2765957446808%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2ia2A02" hits Domain "2g7uD02" (38.4615384615385% over 96.2765957446808%) which is currently in process

Update comment by auto on 27 Aug 2007 06:13

Domain "2ia2A02" hits Domain "2g7uD02" (38.4615384615385% over 96.2765957446808%) which is currently in process

Flow stage update by auto on 27 Aug 2007 06:12

Domain "2ia2A02" hits Domain "2g7uD02" (38.4615384615385% over 96.2765957446808%) which is currently in process

Flow stage update by auto on 27 Aug 2007 06:12

NW result present for Domain "2ia2A02"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2ia2A02"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2ia2A02"

Insertion by cuff on 20 Aug 2007 14:17

nice chopping