CATH Domain: 2i9uA02 XML data for domain: 2i9uA02

Molscript image for 2i9uA02
2i9uA02
PDB coordinates for domain 2i9uA02

PDB 2i9u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.140 Metal-dependent hydrolases Gene3D
3.20.20.140.17
3.20.20.140.17.1
3.20.20.140.17.1.1
3.20.20.140.17.1.1.1
3.20.20.140.17.1.1.1.1

[top]
Segment boundaries for domain 2i9uA02

Chopping figure for domain 2i9uA02
DomainStart PDB ResidueStop PDB Residue
2i9uA01 9 67
2i9uA01 376 427
2i9uA02 68 375

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.20.20.140.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oodA02 90.31 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 3.20.20.140 318 27 94 1.33 1.41
2pajA02 83.65 3.20.20.140 276 20 84 2.38 2.82
2qt3A02 79.81 N-isopropylammelide isopropyl amidohydrolasePseudomonas sp. ADP 3.20.20.140 301 13 87 3.49 4.01
3be7A02 77.68 3.20.20.140 295 10 78 3.83 4.89
3feqC02 77.08 3.20.20.140 299 11 78 3.26 4.13
1zzmA00 73.62 Uncharacterized deoxyribonuclease yjjVTatD DNase family protein [EC:3.1.21.-]Escherichia coli K-12 3.20.20.140 259 11 75 3.54 4.68
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i9uA02
GMNDLHAHASQYKNLGIGMDKELLPWLNNYTFPEEAKFLNVDYAKKTYGRLIKDLIKNGTTRVALFATLHKDSTIELFNM
LIKSGIGAYVGKVNMDYNCPDYLTENYITSLNDTEEIILKYKDKSNIVKPIITPRFVPSCSNELMDGLGKLSYKYRLPVQ
SHLSENLDEIAVVKSLHKKSNFYGEVYDKFGLFGNTPTLMAHCIHSSKEEINLIKRNNVTIVHCPTSNFNLGSGMMPVRK
YLNLGINVVLGSDISAGHTCSLFKVIAYAIQNSKIKWQESGKKDMFLSTSEAFYMATKKGGSFFGKVG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i9uA02
GMNDLHAHASQYKNLGIGMDKELLPWLNNYTFPEEAKFLNVDYAKKTYGRLIKDLIKNGTTRVALFATLHKDSTIELFNM
LIKSGIGAYVGKVNMDYNCPDYLTENYITSLNDTEEIILKYKDKSNIVKPIITPRFVPSCSNELMDGLGKLSYKYRLPVQ
SHLSENLDEIAVVKSLHKKSNFYGEVYDKFGLFGNTPTLMAHCIHSSKEEINLIKRNNVTIVHCPTSNFNLGSGMMPVRK
YLNLGINVVLGSDISAGHTCSLFKVIAYAIQNSKIKWQESGKKDMFLSTSEAFYMATKKGGSFFGKVG
BLAST against CATH

[top]
Domain History Events (55)

Domain assigned by cuff on 13 Feb 2008 15:20

i agree. same superfamily

Homcheck comment by tronnberg on 25 Sep 2007 12:36

I think based on the similarities with 1ra0A02 that the query can be assigned to the 3.20.20.140 homology (same homolgy as the chosen macth). The match and query have similar structure, linkage and function (guanine deaminase).

Domain scan sam cath by auto on 25 Sep 2007 10:37

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 2i9uA02

Domain assignment manual match h by rupa on 10 Sep 2007 10:29

Excellent ssap score, same fold good sequence similarity.

Homcheck review by rupa on 10 Sep 2007 10:29

Excellent ssap score, same fold good sequence similarity.

Flow stage update by rupa on 10 Sep 2007 10:29

Excellent ssap score, same fold good sequence similarity.

Homcheck allotment by rupa on 10 Sep 2007 10:27

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 10 Sep 2007 10:27

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Sep 2007 23:48

Domain "2i9uA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Sep 2007 23:45

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i9uA02

Flow stage update by auto on 09 Sep 2007 23:37

Retrieved PRC_PFAMCATH results for job ID SID8293504346219520 and results inserted.

Domain scan prc pfamcath by auto on 09 Sep 2007 23:35

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 82 results for 2i9uA02

Update comment by auto on 09 Sep 2007 20:31

PRC_PFAMCATH job SID8293504346219520 is not yet finished.

Flow stage update by auto on 09 Sep 2007 20:29

The entry "2i9uA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 09 Sep 2007 20:29

The entry "2i9uA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Sep 2007 19:21

Retrieved SSAP results for job ID SID3121601682956404 and results inserted.

Domain scan ssap cath by auto on 09 Sep 2007 19:20

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 373 results for 2i9uA02

Update comment by auto on 05 Sep 2007 19:23

SSAP job SID3121601682956404 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:51

The entry "2i9uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:51

The entry "2i9uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 07:00

Retrieved PRC results for job ID SID7104426739014624 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 07:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 2i9uA02

Prc cath submit by auto on 05 Sep 2007 03:27

The entry "2i9uA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:27

The entry "2i9uA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:47

Retrieved HMM(SAM) results for job ID SID0071267297193344 and inserted them into the database.

Update comment by auto on 04 Sep 2007 11:38

HMM(SAM) job SID0071267297193344 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:42

The entry "2i9uA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:42

The entry "2i9uA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:43

Retrieved "2i9uA02" CATHEDRAL results for job ID SID0321638032727168 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:42

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2i9uA02

Cathedral cath submit by auto on 03 Sep 2007 13:49

The entry "2i9uA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:49

The entry "2i9uA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:45

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i9uA02.scanlist" for "2i9uA02"

Write scan list by auto on 03 Sep 2007 11:45

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i9uA02.scanlist" for domain "2i9uA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:57

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2i9uA02" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2i9uA02"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2i9uA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2i9uA02"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping