CATH Domain: 2i9uA01 XML data for domain: 2i9uA01

Molscript image for 2i9uA01
2i9uA01
PDB coordinates for domain 2i9uA01

PDB 2i9u, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.6
2.30.40.10.6.1
2.30.40.10.6.1.1
2.30.40.10.6.1.1.1
2.30.40.10.6.1.1.1.1

[top]
Segment boundaries for domain 2i9uA01

Chopping figure for domain 2i9uA01
DomainStart PDB ResidueStop PDB Residue
2i9uA01 9 67
2i9uA01 376 427
2i9uA02 68 375

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 2.30.40.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2oodA01 87.06 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 20 78 1.68 2.14
3feqA01 85.90 2.30.40.10 105 14 85 2.07 2.42
2vhlB01 84.30 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 20 74 2.02 2.70
2qs8A01 84.21 2.30.40.10 99 17 84 2.63 3.11
2qt3A01 84.02 N-isopropylammelide isopropyl amidohydrolasePseudomonas sp. ADP 2.30.40.10 100 16 79 2.31 2.91
2pajA01 84.02 2.30.40.10 119 13 89 2.82 3.14
2gwnA01 83.95 Pyrimidine metabolismDihydroorotaseDihydroorotase [EC:3.5.2.3]Porphyromonas gingivalisMetabolic pathways 2.30.40.10 96 12 74 2.68 3.58
1yrrA01 83.61 Amino sugar and nucleotide sugar metabolismEscherichia coli O157:H7N-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 18 73 1.71 2.31
1rk6A01 83.05 D-aminoacylaseAlcaligenes faecalis 2.30.40.10 87 19 71 2.03 2.85
1gkrA01 83.01 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 22 70 2.31 3.29
3be7A01 81.89 2.30.40.10 95 18 79 2.23 2.81
1gkpA01 81.29 HydrolaseThermus sp. 2.30.40.10 81 17 65 2.43 3.69
2imrA01 76.37 Uncharacterized protein DR_0824Deinococcus radiodurans 2.30.40.10 69 10 58 2.72 4.64
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i9uA01
NLKIFKGNLIFTKTSDKFTIMKDSYIVVIDGKIASVSSNLPDKYKGNPIIDFRNNIIIPSFEEGYDFDALVINDSNLYPE
DYDLTERLERFIYLGDDRNIMKRYVCGNEIF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i9uA01
MSLLEKDINLKIFKGNLIFTKTSDKFTIMKDSYIVVIDGKIASVSSNLPDKYKGNPIIDFRNNIIIPSFEEGYDFDALVI
NDSNLYPEDYDLTERLERFIYLGDDRNIMKRYVCGNEIFGPKFEGHHHHHH
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 11 Feb 2008 15:48

nice scores thoughout. all top hits are with superfamily 2.30.40.10.

Domain assignment manual match h by tronnberg on 10 Sep 2007 10:33

SSAP: 82.87 OV: 78 SEQ: 12. Similar linkage and structure. Functionally similar, Cytosine deaminase (match) and Cytosine/guanine deaminase (query).

Homcheck review by tronnberg on 10 Sep 2007 10:33

SSAP: 82.87 OV: 78 SEQ: 12. Similar linkage and structure. Functionally similar, Cytosine deaminase (match) and Cytosine/guanine deaminase (query).

Flow stage update by tronnberg on 10 Sep 2007 10:33

SSAP: 82.87 OV: 78 SEQ: 12. Similar linkage and structure. Functionally similar, Cytosine deaminase (match) and Cytosine/guanine deaminase (query).

Homcheck allotment by tronnberg on 10 Sep 2007 10:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Sep 2007 10:26

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 17:17

Domain "2i9uA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 17:16

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i9uA01

Flow stage update by auto on 07 Sep 2007 17:08

Retrieved PRC_PFAMCATH results for job ID SID0167945128021184 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 17:07

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 53 results for 2i9uA01

Update comment by auto on 07 Sep 2007 12:05

PRC_PFAMCATH job SID0167945128021184 is not yet finished.

Prc pfamcath submit by auto on 07 Sep 2007 11:45

The entry "2i9uA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 11:45

The entry "2i9uA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 10:44

Retrieved SSAP results for job ID SID5753695948589158 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 10:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1069 results for 2i9uA01

Update comment by auto on 06 Sep 2007 15:15

SSAP job SID5753695948589158 is not yet finished.

Ssap cath submit by auto on 06 Sep 2007 14:26

The entry "2i9uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 06 Sep 2007 14:26

The entry "2i9uA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 06 Sep 2007 14:25

Retrieved PRC results for job ID SID2981211087389844 and inserted them into the database.

Domain scan prc cath by auto on 06 Sep 2007 14:23

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2i9uA01

Update comment by auto on 05 Sep 2007 18:48

PRC job SID2981211087389844 is not yet finished.

Prc cath submit by auto on 05 Sep 2007 18:48

The entry "2i9uA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 18:48

The entry "2i9uA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 06:59

Unable to retrieve "2i9uA01" PRC results for job "SID6198508901167888"

Flow stage update by auto on 05 Sep 2007 03:26

The entry "2i9uA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:26

The entry "2i9uA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:46

Retrieved HMM(SAM) results for job ID SID5500452583118848 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2i9uA01

Update comment by auto on 04 Sep 2007 11:38

HMM(SAM) job SID5500452583118848 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:42

The entry "2i9uA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:42

The entry "2i9uA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:42

Retrieved "2i9uA01" CATHEDRAL results for job ID SID0649650700090560 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:41

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 197 results for 2i9uA01

Cathedral cath submit by auto on 03 Sep 2007 13:49

The entry "2i9uA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:49

The entry "2i9uA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:45

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i9uA01.scanlist" for "2i9uA01"

Write scan list by auto on 03 Sep 2007 11:45

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i9uA01.scanlist" for domain "2i9uA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:57

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2i9uA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2i9uA01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2i9uA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2i9uA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping