CATH Domain: 2i9dA00 XML data for domain: 2i9dA00

Molscript image for 2i9dA00
2i9dA00
PDB coordinates for domain 2i9dA00

PDB 2i9d, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.559 Chloramphenicol Acetyltransferase
3.30.559.10 Chloramphenicol Acetyltransferase Gene3D
3.30.559.10.2
3.30.559.10.2.1
3.30.559.10.2.1.1
3.30.559.10.2.1.1.1
3.30.559.10.2.1.1.1.1

[top]
Segment boundaries for domain 2i9dA00

Chopping figure for domain 2i9dA00
DomainStart PDB ResidueStop PDB Residue
2i9dA00 2 214

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2i9dA00
KQIIDIENWERKENFNFFRHFQNPQLSITSEVECGGARQRAKAAGQSFFLHYLYAVLRAANEIPEFRYRIDPDGRVVLYD
TIDLSPIKIKENGKFFTTRFPYHNDFDTFYQEARLIIDAIPEDGDPYAAENEEVADGDYGLILLSATPDLYFTSITGTQE
KRSGNNYPLLNAGKAIIREGRLVPIATIHHGFIDGHHLSLFYKKVEDFLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i9dA00
SNAXKQIIDIENWERKENFNFFRHFQNPQLSITSEVECGGARQRAKAAGQSFFLHYLYAVLRAANEIPEFRYRIDPDGRV
VLYDTIDXLSPIKIKENGKFFTTRFPYHNDFDTFYQEARLIIDAIPEDGDPYAAENEEVADGDYGLILLSATPDLYFTSI
TGTQEKRSGNNYPLLNAGKAIIREGRLVXPIAXTIHHGFIDGHHLSLFYKKVEDFLK
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 11 Feb 2008 14:22

Assigning to "3.30.559.10" based on similarity with "2i9dB00"

Flow stage update by auto on 11 Feb 2008 14:19

No in_process hits for Domain "2i9dA00" ready to be processed

Update comment by auto on 11 Feb 2008 14:14

Domain "2i9dA00" hits Domain "2i9dB00" (98.1566820276498% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2i9dA00" hits Domain "2i9dC00" (98.1566820276498% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2i9dA00" hits Domain "2i9dC00" (98.1566820276498% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2i9dA00" hits Domain "2i9dC00" (98.1566820276498% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2i9dA00" hits Domain "2i9dC00" (98.1566820276498% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2i9dA00"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2i9dA00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2i9dA00"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping