CATH Domain: 2i9cA01 XML data for domain: 2i9cA01

Molscript image for 2i9cA01
2i9cA01
PDB coordinates for domain 2i9cA01

PDB 2i9c, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.70 Gene3D
1.25.40.70.2
1.25.40.70.2.1
1.25.40.70.2.1.1
1.25.40.70.2.1.1.1
1.25.40.70.2.1.1.1.1

[top]
Segment boundaries for domain 2i9cA01

Chopping figure for domain 2i9cA01
DomainStart PDB ResidueStop PDB Residue
2i9cA01 8 118

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.25.40.70.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jm0A00 75.71 1.20.5.420 48 6 37 0.97 2.60
4hb1A00 74.71 1.20.5.420 44 9 39 1.84 4.69
1qojA00 74.32 Nucleotide excision repairUvrABC system protein BExcinuclease ABC subunit BEscherichia coli K-12 4.10.860.10 43 6 41 1.93 4.69
2jdiH02 72.14 F-type H+-transporting ATPase subunit delta [EC:3.6.3.14]Huntington's diseaseOxidative phosphorylationParkinson's diseaseBos taurus 1.20.5.440 42 9 38 1.35 3.53
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i9cA01
QTTQDLVALFAKVTVEQDDALLGNQISRFNRLFGVAEIADELKARDGDQRTALLSLFEYPNQVRLQAAKLTLAVAPVKAR
EQLEAIVSSKWFPQAGDAGCLDLLDDG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i9cA01
QXTTQDLVALFAKVTVEQDDALLGNQISRFNRLFGVXAEIADELKARDGDQRTALLSLFEYPNXQVRLQAAKLTLAVAPV
KAREQLEAIVSSKWFPQAGDAGXCLDLLDDG
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 10 Mar 2008 17:34

same superfamily

Domain assignment manual match h by cuff on 10 Mar 2008 17:32

same superfamily in scop. i concur

Domain assignment manual match t by tronnberg on 07 Sep 2007 14:49

SSAP: 76.98 OV: 79 SEQ: 7. Reasonable similar and linkage. The query's function is unknown.

Homcheck review by tronnberg on 07 Sep 2007 14:49

SSAP: 76.98 OV: 79 SEQ: 7. Reasonable similar and linkage. The query's function is unknown.

Flow stage update by tronnberg on 07 Sep 2007 14:49

SSAP: 76.98 OV: 79 SEQ: 7. Reasonable similar and linkage. The query's function is unknown.

Homcheck allotment by tronnberg on 07 Sep 2007 14:47

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 14:47

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 12:26

Domain "2i9cA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 12:25

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i9cA01

Flow stage update by auto on 07 Sep 2007 12:05

Retrieved PRC_PFAMCATH results for job ID SID1525941255785430 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 12:04

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2i9cA01

Update comment by auto on 07 Sep 2007 09:08

PRC_PFAMCATH job SID1525941255785430 is not yet finished.

Prc pfamcath submit by auto on 07 Sep 2007 09:06

The entry "2i9cA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 09:06

The entry "2i9cA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 08:06

Retrieved SSAP results for job ID SID4045187268313182 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 08:00

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1942 results for 2i9cA01

Update comment by auto on 06 Sep 2007 15:15

SSAP job SID4045187268313182 is not yet finished.

Ssap cath submit by auto on 06 Sep 2007 14:26

The entry "2i9cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 06 Sep 2007 14:26

The entry "2i9cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 06 Sep 2007 14:23

Retrieved PRC results for job ID SID0607133167491184 and inserted them into the database.

Domain scan prc cath by auto on 06 Sep 2007 14:21

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2i9cA01

Update comment by auto on 05 Sep 2007 18:48

PRC job SID0607133167491184 is not yet finished.

Prc cath submit by auto on 05 Sep 2007 18:48

The entry "2i9cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 18:48

The entry "2i9cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 06:56

Unable to retrieve "2i9cA01" PRC results for job "SID6462711456144704"

Prc cath submit by auto on 05 Sep 2007 03:23

The entry "2i9cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:23

The entry "2i9cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:42

Retrieved HMM(SAM) results for job ID SID7396770534165456 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:41

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2i9cA01

Update comment by auto on 04 Sep 2007 11:37

HMM(SAM) job SID7396770534165456 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:41

The entry "2i9cA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:41

The entry "2i9cA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:38

Retrieved "2i9cA01" CATHEDRAL results for job ID SID8819636048259032 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:37

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 164 results for 2i9cA01

Cathedral cath submit by auto on 03 Sep 2007 13:48

The entry "2i9cA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:48

The entry "2i9cA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:44

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i9cA01.scanlist" for "2i9cA01"

Write scan list by auto on 03 Sep 2007 11:44

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i9cA01.scanlist" for domain "2i9cA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:05

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 31 Aug 2007 19:57

No satisfactory AssignClose result found.

Flow stage update by auto on 31 Aug 2007 19:48

No in_process hits for Domain "2i9cA01" ready to be processed

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2i9cA01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2i9cA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2i9cA01"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping