CATH Domain: 2i8dA02 XML data for domain: 2i8dA02

Molscript image for 2i8dA02
2i8dA02
PDB coordinates for domain 2i8dA02

PDB 2i8d, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.420 Immunoglobulin FC, subunit C Gene3D
1.20.5.420.5
1.20.5.420.5.1
1.20.5.420.5.1.1
1.20.5.420.5.1.1.1
1.20.5.420.5.1.1.1.1

[top]
Segment boundaries for domain 2i8dA02

Chopping figure for domain 2i8dA02
DomainStart PDB ResidueStop PDB Residue
2i8dA01 2 82
2i8dA02 83 114

Structural Neighbourhood (25 entries)

There are 25 matching structural neighberhood comparisons for CATH ID 1.20.5.420.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 25 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ow6A01 83.59 Focal adhesion kinase 1Focal adhesionCytoskeletonIntegrin-mediated signaling pathwayHomo sapiens 1.20.5.540 30 3 70 2.95 4.21
2hr3A01 81.98 Probable transcriptional regulatorPseudomonas aeruginosa 1.20.5.420 30 6 63 2.30 3.63
1fdoA05 81.62 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 1.20.5.460 27 3 73 3.38 4.61
1ozhA03 80.82 Acetolactate synthase, catabolicKlebsiella pneumoniae 1.20.5.740 24 0 63 2.45 3.87
2p10B02 80.74 Mesorhizobium lotiMll9387 protein 1.20.5.460 26 3 56 0.56 0.99
1a2xB00 80.66 Troponin I, fast skeletal muscleTroponin T bindingOryctolagus cuniculus 1.20.5.420 31 0 61 1.40 2.28
2g8yA03 80.38 Uncharacterized oxidoreductase [EC:1.1.1.-]Uncharacterized oxidoreductase ybiCEscherichia coli K-12 1.20.5.460 28 3 73 2.32 3.16
1h8bB00 80.12 TitinOryctolagus cuniculus 1.20.5.510 23 8 66 2.06 3.09
1vl2B03 79.72 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 30 10 63 1.65 2.61
1s3jB01 79.63 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.20.5.420 30 3 56 1.27 2.24
1vl2A03 79.61 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 32 10 65 2.89 4.40
1k04A01 79.61 Focal adhesion kinase 1Focal adhesionIntegrin-mediated signaling pathwayCytoskeletonHomo sapiens 1.20.5.540 38 13 76 3.36 4.40
1vf5C03 79.45 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 10 65 2.92 4.45
2o01J01 77.67 Photosystem I reaction center subunit IXSpinacia oleracea 1.20.5.510 25 12 63 2.26 3.57
2qiwA02 77.33 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 11 60 2.31 3.85
1qexA01 76.75 Enterobacteria phage T4Baseplate structural protein Gp9 1.20.5.960 35 0 54 2.60 4.79
1mkmA02 75.29 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 0 46 0.60 1.29
2aefB02 74.63 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 1.20.5.870 28 0 43 0.41 0.95
1onvB00 74.62 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 4 63 1.69 2.67
1d66B02 73.52 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 0 50 2.00 4.00
1dd4D01 73.41 Thermotoga maritima50S ribosomal protein L7/L12 1.20.5.710 30 3 53 2.37 4.44
1fs0E02 72.50 Oxidative phosphorylationMetabolic pathwaysATP synthase epsilon chainF-type H+-transporting ATPase subunit epsilon [EC:3.6.3.14]Escherichia coli K-12 1.20.5.440 38 3 39 0.73 1.85
2r44A01 71.74 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 3 43 0.29 0.67
1vq8P02 68.01 50S ribosomal protein L19eRibosomeLarge subunit ribosomal protein L19eHaloarcula marismortui 1.20.5.560 33 0 45 2.26 4.97
2jdiH02 65.68 F-type H+-transporting ATPase subunit delta [EC:3.6.3.14]Huntington's diseaseOxidative phosphorylationParkinson's diseaseBos taurus 1.20.5.440 42 3 33 0.65 1.95
[1]
Displaying entries 1 to 25 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i8dA02
YDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i8dA02
YDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKK
BLAST against CATH

[top]
Domain History Events (78)

Domain assigned by cuff on 14 May 2008 18:47

same superfamily

Domain assignment manual match h by cuff on 14 May 2008 18:44

same superfamily

Domain assignment manual match t by tronnberg on 07 Sep 2007 14:46

SSAP: 83.59 OV: 70 SEQ: 3. Not to many linkages nor structure to this query with unknown function.

Homcheck review by tronnberg on 07 Sep 2007 14:46

SSAP: 83.59 OV: 70 SEQ: 3. Not to many linkages nor structure to this query with unknown function.

Flow stage update by tronnberg on 07 Sep 2007 14:46

SSAP: 83.59 OV: 70 SEQ: 3. Not to many linkages nor structure to this query with unknown function.

Homcheck allotment by tronnberg on 07 Sep 2007 14:43

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 14:43

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 12:25

Domain "2i8dA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 12:24

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i8dA02

Flow stage update by auto on 07 Sep 2007 12:04

Retrieved PRC_PFAMCATH results for job ID SID7221957338436976 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 12:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2i8dA02

Update comment by auto on 07 Sep 2007 09:08

PRC_PFAMCATH job SID7221957338436976 is not yet finished.

Prc pfamcath submit by auto on 07 Sep 2007 09:06

The entry "2i8dA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 09:06

The entry "2i8dA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 08:00

Retrieved SSAP results for job ID SID0090690633048128 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 07:57

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 637 results for 2i8dA02

Update comment by auto on 06 Sep 2007 15:15

SSAP job SID0090690633048128 is not yet finished.

Flow stage update by auto on 06 Sep 2007 14:25

The entry "2i8dA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 06 Sep 2007 14:25

The entry "2i8dA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 06 Sep 2007 14:21

Retrieved PRC results for job ID SID0020871551637384 and inserted them into the database.

Domain scan prc cath by auto on 06 Sep 2007 14:20

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2i8dA02

Update comment by auto on 05 Sep 2007 18:48

PRC job SID0020871551637384 is not yet finished.

Prc cath submit by auto on 05 Sep 2007 18:48

The entry "2i8dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 18:48

The entry "2i8dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 06:56

Unable to retrieve "2i8dA02" PRC results for job "SID8919813433948320"

Prc cath submit by auto on 05 Sep 2007 03:22

The entry "2i8dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:22

The entry "2i8dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:41

Retrieved HMM(SAM) results for job ID SID3377972052370328 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:40

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2i8dA02

Update comment by auto on 04 Sep 2007 11:37

HMM(SAM) job SID3377972052370328 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:41

The entry "2i8dA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:41

The entry "2i8dA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:37

Retrieved "2i8dA02" CATHEDRAL results for job ID SID6862897712637458 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:36

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 0 results for 2i8dA02

Cathedral cath submit by auto on 03 Sep 2007 13:48

The entry "2i8dA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:48

The entry "2i8dA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:44

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i8dA02.scanlist" for "2i8dA02"

Write scan list by auto on 03 Sep 2007 11:44

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i8dA02.scanlist" for domain "2i8dA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:14

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:13

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:40

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:11

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:35

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:15

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:04

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:22

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:28

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:32

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:13

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:11

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:19

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:20

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:13

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:25

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:31

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Aug 2007 06:29

No satisfactory AssignClose result found.

Flow stage update by auto on 27 Aug 2007 06:12

No in_process hits for Domain "2i8dA02" ready to be processed

Flow stage update by auto on 27 Aug 2007 06:12

NW result present for Domain "2i8dA02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2i8dA02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2i8dA02"

Insertion by cuff on 18 Aug 2007 13:26

nice chopping