CATH Domain: 2i7hA00 XML data for domain: 2i7hA00

Molscript image for 2i7hA00
2i7hA00
PDB coordinates for domain 2i7hA00

PDB 2i7h, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.109 NADH Oxidase
3.40.109.10 NADH Oxidase Gene3D
3.40.109.10.12
3.40.109.10.12.1
3.40.109.10.12.1.1
3.40.109.10.12.1.1.1
3.40.109.10.12.1.1.1.1

Segment boundaries for domain 2i7hA00

Chopping figure for domain 2i7hA00
DomainStart PDB ResidueStop PDB Residue
2i7hA00 0 186

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.109.10.12.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkwA01 75.64 Thermotoga maritimaPutative uncharacterized protein 3.40.109.10 118 15 60 2.98 4.91
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2i7hA00
ATTYTSIANVIKERRSVRTFTDKAVEKDLLIELLNDATWAPNHKHREPWNCKLYIGEGRKKLVDAVLNSFTEEERAKRGK
ILSDRFLSTPAQIVVYNEDPRQIQRDEDYAATCAFQNFQLLAWERGLGCVWKSGGLNYNPLFIEGIGLTRGQRIVGILHI
GYFDKAPEGKARTPITEKEIIEG    

Domain COMBS Sequence

>pdb|2i7hA00
SNAXTTYTSIANVIKERRSVRTFTDKAVEKDLLIELLNDATWAPNHKHREPWNCKLYIGEGRKKLVDAVLNSFTEEERAK
RGKILSDRFLSTPAQIVVYXNEDPRQIQRDEDYAATCAFXQNFQLLAWERGLGCVWKSGGLNYNPLFIEGIGLTRGQRIV
GILHIGYFDKAPEGKARTPITEKXEIIEG    

Domain History Events (12)

Domain assigned by auto on 11 Feb 2008 14:14

Assigning to "3.40.109.10" based on similarity with "2i7hF00"

Flow stage update by auto on 11 Feb 2008 14:04

No in_process hits for Domain "2i7hA00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Update comment by auto on 27 Jun 2007 22:03

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Flow stage update by auto on 25 Jun 2007 18:02

Domain "2i7hA00" hits Domain "2i7hF00" (97.8835978835979% over 100%) which is currently in process

Flow stage update by auto on 25 Jun 2007 18:02

NW result present for Domain "2i7hA00"

Flow stage update by auto on 25 Jun 2007 18:02

All required files are present for Domain "2i7hA00"

Flow stage update by auto on 25 Jun 2007 18:02

Beginning processing for Domain "2i7hA00"

Insertion by auto on 30 May 2007 21:59

Final ChopClose added based on similarity with "2i7hD"