Classification merge by cuff on 12 Nov 2010 19:13
COMMENT: merge fold and superfamily FINAL: merge: 1.10.164.10 --> 1.10.150.240
CATH Domain: 2i6xA02
2i6xA02
PDB 2i6x, Chain A, Domain 2
Segment boundaries for domain 2i6xA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2i6xA01 | 0 | 13 |
| 2i6xA01 | 88 | 207 |
| 2i6xA02 | 14 | 87 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2i6xA02 IHLNREESIRRFKAIGVADIEELDPKGLFLDLESGRKSEEEFRTELSRYIGKELTYQQVYDALLGFLEEI
Domain History Events (53)
Domain assigned by cuff on 10 Mar 2008 17:44
same superfamily
Domain assignment manual match h by cuff on 10 Mar 2008 17:40
same family in scop
Domain assignment manual match t by tronnberg on 10 Sep 2007 10:25
SSAP: 74.42 OV: 78 SEQ: 14. Reasonable similar linkage and structure. Functionally different.
Homcheck review by tronnberg on 10 Sep 2007 10:25
SSAP: 74.42 OV: 78 SEQ: 14. Reasonable similar linkage and structure. Functionally different.
Flow stage update by tronnberg on 10 Sep 2007 10:25
SSAP: 74.42 OV: 78 SEQ: 14. Reasonable similar linkage and structure. Functionally different.
Homcheck allotment by tronnberg on 10 Sep 2007 10:20
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 10:20
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 07 Sep 2007 17:16
Domain "2i6xA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 07 Sep 2007 17:15
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i6xA02
Flow stage update by auto on 07 Sep 2007 17:07
Retrieved PRC_PFAMCATH results for job ID SID6849802876853632 and results inserted.
Domain scan prc pfamcath by auto on 07 Sep 2007 17:06
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2i6xA02
Update comment by auto on 07 Sep 2007 12:02
PRC_PFAMCATH job SID6849802876853632 is not yet finished.
Prc pfamcath submit by auto on 07 Sep 2007 11:44
The entry "2i6xA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 07 Sep 2007 11:44
The entry "2i6xA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 07 Sep 2007 10:41
Retrieved SSAP results for job ID SID5241445310380544 and results inserted.
Domain scan ssap cath by auto on 07 Sep 2007 10:36
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2089 results for 2i6xA02
Update comment by auto on 05 Sep 2007 19:23
SSAP job SID5241445310380544 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:50
The entry "2i6xA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:50
The entry "2i6xA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 06:54
Retrieved PRC results for job ID SID3585558724265998 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 06:53
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2i6xA02
Flow stage update by auto on 05 Sep 2007 03:19
The entry "2i6xA02" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:19
The entry "2i6xA02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 15:37
Retrieved HMM(SAM) results for job ID SID0162112306716608 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 15:36
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2i6xA02
Update comment by auto on 04 Sep 2007 11:37
HMM(SAM) job SID0162112306716608 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:40
The entry "2i6xA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:40
The entry "2i6xA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 22:33
Retrieved "2i6xA02" CATHEDRAL results for job ID SID1963074302445664 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 22:32
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 15 results for 2i6xA02
Cathedral cath submit by auto on 03 Sep 2007 13:48
The entry "2i6xA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:48
The entry "2i6xA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:44
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i6xA02.scanlist" for "2i6xA02"
Write scan list by auto on 03 Sep 2007 11:43
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i6xA02.scanlist" for domain "2i6xA02"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:14
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:40
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Sep 2007 10:27
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Sep 2007 10:10
No in_process hits for Domain "2i6xA02" ready to be processed
Flow stage update by auto on 01 Sep 2007 10:10
NW result present for Domain "2i6xA02"
Flow stage update by auto on 30 Aug 2007 10:04
All required files are present for Domain "2i6xA02"
Flow stage update by auto on 29 Aug 2007 14:34
Beginning processing for Domain "2i6xA02"
Insertion by cuff on 29 Aug 2007 11:38
nice chopping
