CATH Domain: 2i6hA02 XML data for domain: 2i6hA02

Molscript image for 2i6hA02
2i6hA02
PDB coordinates for domain 2i6hA02

PDB 2i6h, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.10 Gene3D
1.25.40.10.14
1.25.40.10.14.1
1.25.40.10.14.1.1
1.25.40.10.14.1.1.1
1.25.40.10.14.1.1.1.1

Segment boundaries for domain 2i6hA02

Chopping figure for domain 2i6hA02
DomainStart PDB ResidueStop PDB Residue
2i6hA01 2 83
2i6hA02 84 179

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2i6hA02
ATDPLARFFADEAIRRGHDQAVSEDLRVFFYLPFSHAEDIAAQQRACDLNQPLGGLYLHHAEEHRDIVERFGRFPHRNGI
LLRETTPEERQYLEEG    

Domain COMBS Sequence

>pdb|2i6hA02
ATDPLARFFADEAIRRGHDQAVSEDLRVFFYLPFSHAEDIAAQQRACDLNQPLGGLYLHHAEEHRDIVERFGRFPHRNGI
LLRETTPEERQYLEEGGFSGGS    

Domain History Events (12)

Domain assigned by auto on 14 Apr 2008 20:24

Assigning to "1.25.40.10" based on similarity with "2i6hB02"

Flow stage update by auto on 14 Apr 2008 20:08

No in_process hits for Domain "2i6hA02" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2i6hA02" hits Domain "2i6hB02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2i6hA02"

Flow stage update by auto on 10 Jul 2007 02:18

All required files are present for Domain "2i6hA02"

Flow stage update by auto on 09 Jul 2007 19:10

Beginning processing for Domain "2i6hA02"

Insertion by auto on 09 Jul 2007 18:12

Final ChopClose added based on similarity with "2i6hB"