CATH Domain: 2i6dA02 XML data for domain: 2i6dA02

Molscript image for 2i6dA02
2i6dA02
PDB coordinates for domain 2i6dA02

PDB 2i6d, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.5
3.40.1280.10.5.1
3.40.1280.10.5.1.1
3.40.1280.10.5.1.1.1
3.40.1280.10.5.1.1.1.1

[top]
Segment boundaries for domain 2i6dA02

Chopping figure for domain 2i6dA02
DomainStart PDB ResidueStop PDB Residue
2i6dA01 0 93
2i6dA02 94 254

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gz0B02 87.41 RRNA (guanosine-2'-O-)-methyltransferase activityEnzyme-directed rRNA 2'-O-methylationRNA methyltransferase, TrmH family [EC:2.1.1.-]Escherichia coli K-1223S rRNA (guanosine-2'-O-)-methyltransferase rlmB 3.40.1280.10 161 28 88 2.10 2.38
1x7oA02 87.08 RRNA methyltransferaseStreptomyces viridochromogenes 3.40.1280.10 166 25 88 2.28 2.57
2o3aB00 82.60 Hypothetical proteinArchaeoglobus fulgidusTRNA ribose 2'-O-methyltransferase aTrm56 3.40.1280.10 163 13 82 3.35 4.08
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i6dA02
PEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASGALARVQPTPLKNTVDTLAYFRRQGI
PVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVESLNVAIATAILCSEWRRRS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i6dA02
PEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASXGALARVQPTPLKNTVDTLAYFRRQG
IPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVKGHTESLNVAIATAILCSEWRRR
S
BLAST against CATH

[top]
Domain History Events (39)

Domain assigned by cuff on 13 Feb 2008 15:41

i agree, same superfamily

Homcheck comment by tronnberg on 14 Sep 2007 11:04

Similar linkage and structure. Similar function but not identical. The match is a tRNA or rrna methyltransferase and the query is a RNA methyltransferase.

Domain assignment manual match h by tronnberg on 22 Aug 2007 16:32

SSAP= 87, Seq= 28, OV= 88. Share same function as methyltransferas. Very similar linkage.

Homcheck review by tronnberg on 22 Aug 2007 16:32

SSAP= 87, Seq= 28, OV= 88. Share same function as methyltransferas. Very similar linkage.

Flow stage update by tronnberg on 22 Aug 2007 16:32

SSAP= 87, Seq= 28, OV= 88. Share same function as methyltransferas. Very similar linkage.

Homcheck allotment by tronnberg on 22 Aug 2007 16:28

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 22 Aug 2007 16:28

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 May 2007 14:59

Domain "2i6dA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 25 May 2007 14:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i6dA02

Flow stage update by auto on 25 May 2007 14:45

Retrieved PRC_PFAMCATH results for job ID SID6249530507698951 and chopping inserted.

Domain scan prc pfamcath by auto on 25 May 2007 14:45

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 4 results for 2i6dA02

Prc pfamcath submit by auto on 25 May 2007 14:34

The entry "2i6dA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 May 2007 14:34

The entry "2i6dA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 May 2007 14:32

Retrieved SSAP results for job ID SID5329714484794800 and chopping inserted.

Domain scan ssap cath by auto on 25 May 2007 14:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1586 results for 2i6dA02

Update comment by auto on 24 May 2007 08:13

SSAP job SID5329714484794800 is not yet finished.

Ssap cath submit by auto on 24 May 2007 07:59

The entry "2i6dA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 24 May 2007 07:59

The entry "2i6dA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 24 May 2007 07:50

Retrieved PRC results for job ID SID3413535266651200 and inserted them into the database.

Domain scan prc cath by auto on 24 May 2007 07:50

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 5 results for 2i6dA02

Prc cath submit by auto on 24 May 2007 07:14

The entry "2i6dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 24 May 2007 07:14

The entry "2i6dA02" has been submitted to the PRC webservice.

Flow stage update by auto on 24 May 2007 07:03

Retrieved HMM(SAM) results for job ID SID9188323891826688 and inserted them into the database.

Domain scan sam cath by auto on 24 May 2007 07:03

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2i6dA02

Flow stage update by auto on 24 May 2007 06:27

The entry "2i6dA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 24 May 2007 06:27

The entry "2i6dA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 24 May 2007 06:23

Retrieved "2i6dA02" CATHEDRAL results for job ID SID1864527996283452 and inserted them into the database.

Domain scan cathedral cath by auto on 24 May 2007 06:22

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 609 results for 2i6dA02

Update comment by auto on 24 May 2007 03:19

"2i6dA02" CATHEDRAL job SID1864527996283452 is not yet finished.

Cathedral cath submit by auto on 24 May 2007 02:41

The entry "2i6dA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 May 2007 02:41

The entry "2i6dA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 May 2007 02:28

ScanList with 8763 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i6dA02.scanlist" for "2i6dA02"

Write scan list by auto on 24 May 2007 02:28

Writing ScanList containing 8763 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i6dA02.scanlist" for domain "2i6dA02"

Flow stage update by auto on 24 May 2007 02:10

No satisfactory AssignClose result found.

Flow stage update by auto on 14 May 2007 10:03

No in_process hits for Domain "2i6dA02" ready to be processed

Flow stage update by auto on 14 May 2007 10:03

NW result present for Domain "2i6dA02"

Flow stage update by auto on 10 May 2007 21:59

All required files are present for Domain "2i6dA02"

Flow stage update by auto on 10 May 2007 14:08

Beginning processing for Domain "2i6dA02"

Insertion by cuff on 10 May 2007 12:32

good chopping