CATH Domain: 2i6cA00

There are 56 matching structural neighberhood comparisons for CATH ID 3.40.630.30.2.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1vhsB00	85.91	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	21	92	2.49	2.70
	2fiwA00	85.53	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	18	90	3.72	4.12
	3fncA00	85.21	Listeria innocuaLin0611 protein	3.40.630.30	157	16	92	3.67	3.95
	3eo4A00	85.18	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	12	89	2.49	2.78
	1tiqB00	85.06	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	10	89	3.02	3.38
	3k9uA00	84.97	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	14	88	3.25	3.69
	2fiaA00	84.18	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	16	92	3.32	3.57
	2r7hB00	83.90	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	15	89	2.90	3.23
	3exnA00	83.85	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	11	86	2.43	2.81
	2ge3B00	83.69	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	17	89	2.94	3.27
	1s3zA00	83.57	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	18	84	4.13	4.89
	2ae6A00	83.45	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	15	87	3.62	4.16
	3blnA00	83.32	Bacillus cereus ATCC 10987Putative uncharacterized protein	3.40.630.30	139	16	86	3.01	3.49
	2i79D00	83.19	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	13	88	3.30	3.72
	3g8wA00	82.86	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	12	92	3.29	3.56
	1mk4A00	82.84	Bacillus subtilisUncharacterized protein yqjY	3.40.630.30	157	14	85	2.80	3.28
	3d8pB00	82.63	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	9	85	3.42	4.01
	3fbuA00	82.54	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	13	90	2.74	3.03
	1qsmD00	81.84	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	14	86	3.53	4.09
	2ozgA01	81.67	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	15	72	2.57	3.57
	1n71B00	81.67	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	12	80	3.00	3.73
	1gheA00	81.56	Tyrosine metabolismLimonene and pinene degradationAcetyltransferase1- and 2-Methylnaphthalene degradationPhenylalanine metabolism	3.40.630.30	166	20	88	3.11	3.51
	1cjwA00	81.34	Ovis ariesSerotonin N-acetyltransferase	3.40.630.30	166	12	82	3.01	3.65
	2pdoA01	81.27	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	23	74	3.01	4.07
	1yreC00	81.24	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	17	81	3.15	3.85
	2pc1A00	81.11	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	158	12	86	3.97	4.58
	2fckA00	80.96	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	14	85	3.81	4.46
	3f5bA00	80.89	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	9	84	3.44	4.09
	3fb3A00	80.83	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	17	78	3.21	4.09
	3efaA00	80.74	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	12	83	3.14	3.75
	1sqhA02	80.71	Drosophila melanogasterCG14615	3.40.630.30	128	16	72	3.01	4.18
	2i00C01	80.59	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	11	81	3.49	4.27
	1q2yA00	80.50	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	12	84	3.30	3.91
	2qecA00	80.22	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	16	80	3.96	4.91
	1y9kA01	80.20	Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation	3.40.630.30	110	20	70	3.35	4.78
	2fsrA00	80.11	Agrobacterium tumefaciens str. C58Acetyltranferase	3.40.630.30	168	11	82	3.72	4.53
	1xebA00	79.77	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	13	87	4.11	4.72
	2dxqA00	79.60	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	15	82	2.91	3.53
	3d3sA00	79.57	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	14	92	3.42	3.70
	1nslA00	79.36	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	12	84	3.42	4.05
	1y9wA01	79.30	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	20	62	2.64	4.19
	1qstA00	78.81	HAT A1Tetrahymena thermophila	3.40.630.30	160	10	81	3.37	4.12
	2r1iA01	78.74	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	16	73	2.84	3.87
	1y7rA00	78.66	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	7	77	3.35	4.34
	1bo4A00	78.49	Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens	3.40.630.30	136	11	75	3.61	4.75
	2qmlA00	78.42	BH2621 proteinBacillus halodurans	3.40.630.30	184	11	77	3.49	4.49
	2fl4A02	78.42	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	15	64	2.86	4.45
	2oh1C00	78.15	Listeria monocytogenes serotype 4b str. F2365Acetyltransferase, GNAT family	3.40.630.30	166	11	78	3.78	4.83
	2ozhA01	77.78	Xanthomonas campestris pv. campestrisPutative uncharacterized protein	3.40.630.30	120	15	72	3.18	4.41
	3dnsA00	77.43	Ribosomal-protein-alanine N-acetyltransferase [EC:2.3.1.128]Clostridium acetobutylicumRibosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S5)	3.40.630.30	126	8	75	3.66	4.86
	2hqyA02	76.99	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	164	5	76	3.59	4.71
	3gkrA02	76.92	Weissella viridescensFemX	3.40.630.30	165	4	70	3.02	4.26
	2hv2A03	76.79	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	148	6	74	3.41	4.57
	3ey5A01	75.98	Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron	3.40.630.30	144	8	74	3.58	4.79
	1lrzA02	75.97	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	195	6	58	2.73	4.63
	1lrzA01	75.91	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	143	8	79	3.95	4.99

>pdb|2i6cA00
QLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNV
APAARGLGVARYLIGVENLAREQYKARLKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQDKPLEP    

>pdb|2i6cA00
XQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGN
XXVAPAARGLGVARYLIGVXENLAREQYKARLXKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQXDKPLEP