CATH Domain: 2i4aA00 XML data for domain: 2i4aA00

Molscript image for 2i4aA00
2i4aA00
PDB coordinates for domain 2i4aA00

PDB 2i4a, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.30 Glutaredoxin
3.40.30.10 Glutaredoxin Gene3D
3.40.30.10.4
3.40.30.10.4.1
3.40.30.10.4.1.1
3.40.30.10.4.1.1.1
3.40.30.10.4.1.1.1.1

[top]
Segment boundaries for domain 2i4aA00

Chopping figure for domain 2i4aA00
DomainStart PDB ResidueStop PDB Residue
2i4aA00 1 107

Structural Neighbourhood (42 entries)

There are 42 matching structural neighberhood comparisons for CATH ID 3.40.30.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 42 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1thxA00 93.19 Nostoc sp. PCC 7120Thioredoxin-2 3.40.30.10 108 33 99 1.25 1.26
1w4vA00 92.77 Thioredoxin, mitochondrialHomo sapiensThioredoxin 1 3.40.30.10 110 36 97 1.31 1.35
2e0qA00 92.56 Sulfolobus tokodaii140aa long hypothetical thioredoxinThioredoxin 1 3.40.30.10 104 29 95 1.15 1.21
1gh2A00 92.12 CytoplasmHomo sapiensThioredoxin-like protein 1Disulfide oxidoreductase activity 3.40.30.10 107 23 97 1.29 1.33
2vimA00 91.58 Fasciola hepaticaThioredoxin (TRX) 3.40.30.10 104 30 95 1.35 1.42
3gnjA00 90.23 Desulfitobacterium hafniense DCB-2Thioredoxin domain protein 3.40.30.10 107 14 97 2.40 2.47
2pu9C00 90.06 Thioredoxin F-type, chloroplasticSpinacia oleraceaProtein binding 3.40.30.10 111 22 94 1.57 1.66
1r26A00 89.99 Trypanosoma brucei bruceiThioredoxin 3.40.30.10 113 28 92 1.44 1.56
1v98A00 89.81 Thermus thermophilus HB8Thioredoxin 2 [EC:1.8.1.8]Thioredoxin 3.40.30.10 92 40 83 1.71 2.06
2j23A00 89.42 Malassezia sympodialisThioredoxin 3.40.30.10 115 35 91 1.59 1.74
2b5eA01 88.49 Protein disulfide isomerase activityProtein disulfide oxidoreductase activityProtein bindingProtein foldingEndoplasmic reticulum lumen 3.40.30.10 119 17 89 2.09 2.35
2dizA00 88.01 Anti-apoptosisHomo sapiensThioredoxin domain-containing protein 5 3.40.30.10 117 30 89 2.24 2.50
2f51A00 86.88 Trichomonas vaginalisThioredoxin 1Thioredoxin 3.40.30.10 101 36 90 1.91 2.11
2c0gA01 84.83 Protein targeting to GolgiRegulation of multicellular organism growthProtein homodimerization activityEmbryo development ending in birth or egg hatchingDrosophila melanogaster 3.40.30.10 122 16 84 2.37 2.81
1mekA00 84.49 Cell surfaceER-Golgi intermediate compartmentProtein disulfide isomerase activityProtein bindingPeptidyl-proline hydroxylation to 4-hydroxy-L-proline 3.40.30.10 120 23 88 2.36 2.67
1a8yA02 84.08 Calsequestrin-1Oryctolagus cuniculus 3.40.30.10 102 6 89 2.59 2.89
1a8yA01 83.98 Calsequestrin-1Oryctolagus cuniculus 3.40.30.10 124 8 84 2.57 3.04
3gixA00 83.85 Thioredoxin-like protein 4BHomo sapiens 3.40.30.10 133 12 75 1.84 2.42
2b5eA04 83.81 Endoplasmic reticulum lumenProtein disulfide oxidoreductase activityProtein disulfide isomerase activityProlyl 4-hydroxylase, beta polypeptide [EC:5.3.4.1]Saccharomyces cerevisiae 3.40.30.10 140 21 75 2.19 2.92
1wouA00 83.39 Thioredoxin domain-containing protein 17Tumor necrosis factor-mediated signaling pathwayProtein bindingCytosolProtein-disulfide reductase activity 3.40.30.10 119 15 84 2.76 3.25
1qgvA00 83.37 SpliceosomeSpliceosomal complexU5 snRNP protein, DIM1 familyHomo sapiensProtein binding 3.40.30.10 130 19 82 2.17 2.64
2qsiA01 82.74 Putative hydrogenase expression/formation protein hupGHydrogenase-1 operon protein HyaERhodopseudomonas palustris 3.40.30.10 82 17 73 2.06 2.79
2in3A01 82.73 Nitrosomonas europaeaPutative protein-disulfide isomerasePutative uncharacterized protein 3.40.30.10 78 16 69 1.83 2.65
2trcP01 82.11 PhosducinRattus norvegicus 3.40.30.10 131 13 79 2.86 3.60
2kucA00 81.60 Bacteroides thetaiotaomicronPutative disulphide-isomerase 3.40.30.10 121 25 85 2.81 3.27
3kp9A02 81.54 VKORC1/thioredoxin domain proteinSynechococcus sp. JA-2-3B'a(2-13) 3.40.30.10 97 13 75 3.59 4.74
1bjxA00 81.31 Cell surfaceProtein disulfide isomerase activityER-Golgi intermediate compartmentProtein bindingPeptidyl-proline hydroxylation to 4-hydroxy-L-proline 3.40.30.10 110 10 88 2.80 3.18
1ttzA00 80.52 Xanthomonas campestris pv. campestrisPutative uncharacterized protein 3.40.30.10 74 20 69 2.67 3.86
1sjiA03 80.17 Canis lupus familiarisCalsequestrin-2 3.40.30.10 123 7 85 3.13 3.67
2p0gB00 79.15 Vibrio choleraeSelenoprotein W-related proteinSelenoprotein W-related protein 3.40.30.10 79 10 67 2.50 3.72
1senA00 79.00 Protein-disulfide reductase (glutathione) [EC:1.8.4.2]Homo sapiensGlutathione metabolismThioredoxin domain-containing protein 12 3.40.30.10 134 17 77 3.05 3.93
1g7eA00 78.72 Rattus norvegicusEndoplasmic reticulum lumenEndoplasmic reticulum protein 29Transport vesicleEndoplasmic reticulum resident protein 29 3.40.30.10 122 21 82 3.24 3.91
2fa8B00 78.70 Agrobacterium tumefaciens str. C58Selenoprotein W-related proteinPutative uncharacterized protein 3.40.30.10 86 15 69 3.11 4.50
3f9uA00 78.09 Bacteroides fragilis NCTC 9343Putative exported cytochrome C biogenesis-related protein 3.40.30.10 139 11 69 2.83 4.06
1m2dA00 77.83 Ferredoxin, 2Fe-2SAquifex aeolicus 3.40.30.10 101 2 71 2.65 3.73
1egoA00 77.49 Glutaredoxin 1Glutaredoxin-1Protein bindingEscherichia coli K-12 3.40.30.10 85 11 72 3.19 4.38
1h75A00 76.64 Glutaredoxin-like protein NrdHGlutaredoxin-like protein nrdHEscherichia coli K-12 3.40.30.10 76 15 68 3.40 4.98
1t1vA00 76.50 Mus musculusSH3 domain-binding glutamic acid-rich-like protein 3 3.40.30.10 93 8 71 2.80 3.94
1nm3A02 76.40 Peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]Haemophilus influenzaeHybrid peroxiredoxin hyPrx5 3.40.30.10 70 11 62 2.81 4.49
3lgcA00 76.09 Francisella tularensis subsp. tularensisGlutaredoxin 1Glutaredoxin 1 3.40.30.10 86 10 69 3.32 4.80
1iloA00 74.85 Methanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.30.10 77 9 68 2.49 3.65
1fo5A00 72.62 Methanocaldococcus jannaschiiThioredoxin 3.40.30.10 85 18 77 3.48 4.49
[1]
Displaying entries 1 to 42 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i4aA00
SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLML
VRDGKVIDKKVGALPKSQLKAWVESAQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i4aA00
SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLML
VRDGKVIDKKVGALPKSQLKAWVESAQ
BLAST against CATH

[top]
Domain History Events (32)

Domain assigned by auto on 24 Nov 2007 06:06

Assigning to "3.40.30.10" based on similarity with "1zzyA00"

Flow stage update by auto on 24 Nov 2007 06:05

No in_process hits for Domain "2i4aA00" ready to be processed

Update comment by auto on 24 Nov 2007 05:52

Domain "2i4aA00" hits Domain "2i1uA00" (48.5981308411215% over 88.4297520661157%) which is currently in process

Update comment by auto on 24 Nov 2007 05:49

Domain "2i4aA00" hits Domain "2h73B00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:47

Domain "2i4aA00" hits Domain "2h73A00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:44

Domain "2i4aA00" hits Domain "2h70B00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:40

Domain "2i4aA00" hits Domain "2h70A00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:33

Domain "2i4aA00" hits Domain "2h6yB00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:28

Domain "2i4aA00" hits Domain "2h76A00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:17

Domain "2i4aA00" hits Domain "2h74B00" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:13

Domain "2i4aA00" hits Domain "2h75B00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 05:09

Domain "2i4aA00" hits Domain "2h75A00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 04:54

Domain "2i4aA00" hits Domain "2h6xB00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 04:35

Domain "2i4aA00" hits Domain "2h74A00" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 04:11

Domain "2i4aA00" hits Domain "2h72A00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:53

Domain "2i4aA00" hits Domain "2h6zA00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:50

Domain "2i4aA00" hits Domain "2h72B00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:46

Domain "2i4aA00" hits Domain "2h6xA00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:42

Domain "2i4aA00" hits Domain "2h71B00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:38

Domain "2i4aA00" hits Domain "2h71A00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:33

Domain "2i4aA00" hits Domain "2h6yA00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:28

Domain "2i4aA00" hits Domain "2h76B00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:17

Domain "2i4aA00" hits Domain "2h6zB00" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:11

Domain "2i4aA00" hits Domain "2ajqI00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 03:04

Domain "2i4aA00" hits Domain "2ajqB00" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 24 Nov 2007 02:49

Domain "2i4aA00" hits Domain "1v98B00" (41.1111111111111% over 81.3084112149533%) which is currently in process

Update comment by auto on 23 Nov 2007 14:11

Domain "2i4aA00" hits Domain "1v98A00" (40.2173913043478% over 83.1775700934579%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:05

Domain "2i4aA00" hits Domain "1v98A00" (40.2173913043478% over 83.1775700934579%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:03

NW result present for Domain "2i4aA00"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "2i4aA00"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "2i4aA00"

Insertion by auto on 12 Nov 2007 23:12

Final ChopClose added based on similarity with "1zzyA"