Domain assigned by cuff on 12 Feb 2008 15:06
i agree. same superfamily
CATH Domain: 2i2oA00
2i2oA00
PDB 2i2o, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2i2oA00 EDYKIQSFDLETQKLLKTALKDPGSVDLEKVSSVIVDQSLKDQVFSREAGRICYTIVQAEAKQTNGSVFRRNLLNRLQQE FKAREETRKRSTQEWVCLVSFICNIFDYLKVNNPVALVHPVYDCLFRLAQSDALKNEEEVDCLVLQLHRIGDQLEKNVQL DELFNLLRDGFLLQEDLSSGRLLLLEILEFRAGGWKLSDTAQKYYY
Domain History Events (50)
Domain assignment manual match h by rupa on 10 Sep 2007 10:05
Very high ssap score, same fold, and same pfam class.
Homcheck review by rupa on 10 Sep 2007 10:05
Very high ssap score, same fold, and same pfam class.
Flow stage update by rupa on 10 Sep 2007 10:05
Very high ssap score, same fold, and same pfam class.
Homcheck allotment by rupa on 10 Sep 2007 10:03
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 10 Sep 2007 10:03
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 11:30
Domain "2i2oA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 11:30
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i2oA00
Flow stage update by auto on 08 Sep 2007 11:18
Retrieved PRC_PFAMCATH results for job ID SID8877072429595896 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 11:17
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 4 results for 2i2oA00
Update comment by auto on 08 Sep 2007 07:50
PRC_PFAMCATH job SID8877072429595896 is not yet finished.
Prc pfamcath submit by auto on 08 Sep 2007 07:48
The entry "2i2oA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 07:48
The entry "2i2oA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 06:31
Retrieved SSAP results for job ID SID4595878571186704 and results inserted.
Domain scan ssap cath by auto on 08 Sep 2007 06:30
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 474 results for 2i2oA00
Update comment by auto on 05 Sep 2007 19:21
SSAP job SID4595878571186704 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:48
The entry "2i2oA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:48
The entry "2i2oA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 06:40
Retrieved PRC results for job ID SID0860291843497936 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 06:39
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2i2oA00
Prc cath submit by auto on 04 Sep 2007 13:45
The entry "2i2oA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 13:45
The entry "2i2oA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 11:34
Retrieved HMM(SAM) results for job ID SID7199083551783840 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 11:33
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2i2oA00
Flow stage update by auto on 04 Sep 2007 09:39
The entry "2i2oA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 09:39
The entry "2i2oA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 22:18
Retrieved "2i2oA00" CATHEDRAL results for job ID SID0303533973450864 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 22:17
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 76 results for 2i2oA00
Cathedral cath submit by auto on 03 Sep 2007 13:46
The entry "2i2oA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:46
The entry "2i2oA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:42
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i2oA00.scanlist" for "2i2oA00"
Write scan list by auto on 03 Sep 2007 11:41
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i2oA00.scanlist" for domain "2i2oA00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:14
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:13
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:14
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Sep 2007 10:27
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Sep 2007 10:10
No in_process hits for Domain "2i2oA00" ready to be processed
Flow stage update by auto on 01 Sep 2007 10:10
NW result present for Domain "2i2oA00"
Flow stage update by auto on 30 Aug 2007 10:04
All required files are present for Domain "2i2oA00"
Flow stage update by auto on 29 Aug 2007 14:34
Beginning processing for Domain "2i2oA00"
Insertion by cuff on 29 Aug 2007 11:00
nice chopping
