CATH Domain: 2i2lB02 XML data for domain: 2i2lB02

Molscript image for 2i2lB02
2i2lB02
PDB coordinates for domain 2i2lB02

PDB 2i2l, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.100 Gene3D
2.30.30.100.13
2.30.30.100.13.1
2.30.30.100.13.1.1
2.30.30.100.13.1.1.1
2.30.30.100.13.1.1.1.1

[top]
Segment boundaries for domain 2i2lB02

Chopping figure for domain 2i2lB02
DomainStart PDB ResidueStop PDB Residue
2i2lB01 2 53
2i2lB02 54 124

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.30.30.100.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ox7A02 82.48 Enterococcus faecalisPutative uncharacterized protein 2.30.30.290 68 16 91 3.68 4.04
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i2lB02
LWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKDYDVTAVGWVEYATIEVIGDVY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i2lB02
LXWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISADYDVTAVGWVEYATIEVIGDVY
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 12 Feb 2008 20:19

Assigning to "2.30.30.100" based on similarity with "2i2lC02"

Flow stage update by auto on 12 Feb 2008 20:16

No in_process hits for Domain "2i2lB02" ready to be processed

Update comment by auto on 12 Feb 2008 20:05

Domain "2i2lB02" hits Domain "2i2lA02" (98.5915492957746% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2i2lB02" hits Domain "2i2lC02" (98.5915492957746% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2i2lB02" hits Domain "2i2lC02" (98.5915492957746% over 100%) which is currently in process

Update comment by auto on 31 Aug 2007 19:49

Domain "2i2lB02" hits Domain "2i2lC02" (98.5915492957746% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

Domain "2i2lB02" hits Domain "2i2lC02" (98.5915492957746% over 100%) which is currently in process

Flow stage update by auto on 31 Aug 2007 19:48

NW result present for Domain "2i2lB02"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2i2lB02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2i2lB02"

Insertion by auto on 23 Aug 2007 14:25

Final ChopClose added based on similarity with "2i2lA"