CATH Domain: 2i10B01 XML data for domain: 2i10B01

Molscript image for 2i10B01
2i10B01
PDB coordinates for domain 2i10B01

PDB 2i10, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.60 Homeodomain-like Gene3D
1.10.10.60.7
1.10.10.60.7.1
1.10.10.60.7.1.1
1.10.10.60.7.1.1.2
1.10.10.60.7.1.1.2.1

[top]
Segment boundaries for domain 2i10B01

Chopping figure for domain 2i10B01
DomainStart PDB ResidueStop PDB Residue
2i10B01 11 64
2i10B01 114 117
2i10B02 66 113
2i10B02 118 196

Structural Neighbourhood (27 entries)

There are 27 matching structural neighberhood comparisons for CATH ID 1.10.10.60.7.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 27 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bqzA01 88.90 HTH-type transcriptional regulator qacRStaphylococcus aureus subsp. aureus Mu50 1.10.10.60 49 30 79 1.45 1.83
3c2bA01 88.47 Agrobacterium tumefaciens str. C58Transcriptional regulator, TetR family 1.10.10.60 51 25 81 1.49 1.84
2np3B01 87.03 Streptomyces coelicolorPutative TetR-family regulator 1.10.10.60 60 15 85 1.98 2.33
3bqyA01 86.94 Putative transcriptional regulatorStreptomyces coelicolor 1.10.10.60 48 29 81 1.52 1.88
1t33A01 86.70 Putative transcriptional repressor (TetR/AcrR family)Salmonella enterica subsp. enterica serovar Typhimurium 1.10.10.60 62 18 77 1.65 2.13
2raeA01 86.67 Rhodococcus jostii RHA1Transcriptional regulator, AcrR family protein 1.10.10.60 43 27 70 1.32 1.87
3f0cA01 85.99 Cytophaga hutchinsonii ATCC 33406Transcriptional regulator 1.10.10.60 47 21 75 1.54 2.03
2ibdA01 85.98 Rhodococcus jostii RHA1Possible transcriptional regulator 1.10.10.60 45 31 68 1.22 1.77
1zkgA01 85.51 Thermotoga maritimaTranscriptional regulator, TetR family 1.10.10.60 46 17 72 1.66 2.29
2id6A01 85.42 Thermotoga maritimaTranscriptional regulator, TetR family 1.10.10.60 46 17 72 1.43 1.97
1t56A01 85.19 TRANSCRIPTIONAL REGULATORY REPRESSOR PROTEIN (TETR-FAMILY) ETHRMycobacterium tuberculosis 1.10.10.60 46 30 72 1.63 2.25
2fq4A01 84.81 Transcriptional regulator, TetR familyBacillus cereus ATCC 14579 1.10.10.60 47 10 72 1.63 2.25
1rktA01 84.19 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yfiR 1.10.10.60 52 21 68 1.68 2.44
1zk8A01 83.38 Transcriptional regulator, TetR familyBacillus cereus ATCC 14579 1.10.10.60 46 26 72 2.07 2.86
2fd5A01 83.32 Probable transcriptional regulatorPseudomonas aeruginosa 1.10.10.60 48 18 68 1.72 2.49
3dewA01 83.31 TetR/AcrR family transcriptional regulatorTranscriptional regulator, TetR familyGeobacter sulfurreducens 1.10.10.60 50 22 79 2.81 3.54
2hyjA01 82.10 Streptomyces coelicolorPutative tetR-family transcriptional regulator 1.10.10.60 46 19 68 1.74 2.52
2id3A01 81.99 Putative transcriptional regulatorStreptomyces coelicolor 1.10.10.60 47 12 70 1.96 2.77
1u8bA02 81.56 Regulatory protein adaZinc ion bindingAraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC:2.1.1.63]Escherichia coli K-12 1.10.10.60 59 12 83 3.84 4.62
1gv2A02 80.00 Transcriptional activator MybNucleusEmbryonic digestive tract developmentProtein bindingMus musculus 1.10.10.60 46 10 72 2.80 3.87
1bl0A01 78.26 Multiple antibiotic resistance protein marAAraC family transcriptional regulator, multiple antibiotic resistance protein MarAEscherichia coli K-12 1.10.10.60 56 5 84 3.52 4.17
1w0tA00 78.02 Protein homooligomerizationPositive regulation of mitotic cell cycleTelomere maintenance via telomere shorteningNegative regulation of telomerase activityG2/M transition of mitotic cell cycle 1.10.10.60 52 9 81 3.71 4.58
1ng6A02 77.89 Hypothetical proteinBacillus subtilisUncharacterized protein yqeY 1.10.10.410 57 3 77 2.96 3.82
3ccyA01 77.38 Bordetella parapertussisPutative TetR-family transcriptional regulator 1.10.10.60 44 25 67 3.27 4.86
1hlvA02 75.44 Centromere protein BMajor centromere autoantigen BHomo sapiensChromosome, centromeric region 1.10.10.60 60 5 73 2.84 3.87
1iv6A00 75.32 Positive regulation of mitotic cell cycleProtein homooligomerizationNegative regulation of telomerase activityTelomere maintenance via telomere shorteningG2/M transition of mitotic cell cycle 1.10.10.60 57 5 79 3.58 4.51
1fexA00 73.82 Protein bindingTelomeric repeat-binding factor 2-interacting protein 1Protection from non-homologous end joining at telomereNegative regulation of telomere maintenanceCytoplasm 1.10.10.60 59 8 79 3.72 4.67
[1]
Displaying entries 1 to 27 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2i10B01
DQVALQTAELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYSP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2i10B01
GHXPGGRRRGFDDQVALQTAXELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYSGEP
BLAST against CATH

[top]
Domain History Events (43)

Domain assigned by cuff on 11 Feb 2008 15:38

lovely scores, def homology

Domain assignment manual match h by rupa on 07 Sep 2007 13:34

Very high ssap score, same fold, same function and high sequence similarity.

Homcheck review by rupa on 07 Sep 2007 13:34

Very high ssap score, same fold, same function and high sequence similarity.

Flow stage update by rupa on 07 Sep 2007 13:34

Very high ssap score, same fold, same function and high sequence similarity.

Homcheck allotment by rupa on 07 Sep 2007 13:32

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 07 Sep 2007 13:32

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 12:14

Domain "2i10B01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 12:13

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i10B01

Flow stage update by auto on 07 Sep 2007 11:53

Retrieved PRC_PFAMCATH results for job ID SID6465029611285560 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 11:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 38 results for 2i10B01

Update comment by auto on 07 Sep 2007 09:07

PRC_PFAMCATH job SID6465029611285560 is not yet finished.

Prc pfamcath submit by auto on 07 Sep 2007 09:04

The entry "2i10B01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 09:04

The entry "2i10B01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 06:59

Retrieved SSAP results for job ID SID3925418046692944 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 06:54

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1775 results for 2i10B01

Update comment by auto on 05 Sep 2007 19:20

SSAP job SID3925418046692944 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:47

The entry "2i10B01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:47

The entry "2i10B01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 06:30

Retrieved PRC results for job ID SID6844261674061824 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 06:29

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 33 results for 2i10B01

Flow stage update by auto on 05 Sep 2007 03:17

The entry "2i10B01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:17

The entry "2i10B01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:21

Retrieved HMM(SAM) results for job ID SID0775878004370112 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:20

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 29 results for 2i10B01

Update comment by auto on 04 Sep 2007 11:27

HMM(SAM) job SID0775878004370112 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:38

The entry "2i10B01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:38

The entry "2i10B01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 22:09

Retrieved "2i10B01" CATHEDRAL results for job ID SID8482303885102368 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 22:08

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 78 results for 2i10B01

Flow stage update by auto on 03 Sep 2007 13:45

The entry "2i10B01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 13:45

The entry "2i10B01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:40

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i10B01.scanlist" for "2i10B01"

Write scan list by auto on 03 Sep 2007 11:40

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i10B01.scanlist" for domain "2i10B01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Sep 2007 22:29

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Sep 2007 22:22

No in_process hits for Domain "2i10B01" ready to be processed

Flow stage update by auto on 02 Sep 2007 22:22

NW result present for Domain "2i10B01"

Flow stage update by auto on 01 Sep 2007 14:04

All required files are present for Domain "2i10B01"

Flow stage update by auto on 31 Aug 2007 19:48

Beginning processing for Domain "2i10B01"

Insertion by cuff on 31 Aug 2007 13:23

nice chopping