Domain assigned by cuff on 12 Feb 2008 17:07
same superfamily
CATH Domain: 2i09A01
2i09A01
PDB 2i09, Chain A, Domain 1
Segment boundaries for domain 2i09A01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2i09A01 | 2 | 105 |
| 2i09A01 | 227 | 403 |
| 2i09A02 | 106 | 226 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2i09A01 STFNRIHLVVLDSVGIGAAPDANNFSNAGVPDGASDTLGHISKTVGLNVPNMAKIGLGNIPRDTPLKTVPAENHPTGYVT KLEEVSLGKDTMTGHWEIMGLNITSPFAPTVLNKLADAGVSTYAVGKINDIFNGSGITNDMGHNKSNSHGVDTLIKTMGL SAFTKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMKVDDLLLITADHGNDPTYAGTDHTREYVPLLAYS PSFTGNGVLPVGHYADISATIADNFGVDTAMIGESFLDKLI
Domain COMBS Sequence
>pdb|2i09A01 MSTFNRIHLVVLDSVGIGAAPDANNFSNAGVPDGASDTLGHISKTVGLNVPNMAKIGLGNIPRDTPLKTVPAENHPTGYV TKLEEVSLGKDTMTGHWEIMGLNITSPFAPTVLNKLADAGVSTYAVGKINDIFNGSGITNDMGHNKSNSHGVDTLIKTMG LSAFTKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMKVDDLLLITADHGNDPTYAGTDHTREYVPLLAY SPSFTGNGVLPVGHYADISATIADNFGVDTAMIGESFLDKLI
Domain History Events (74)
Domain assignment manual match h by cuff on 12 Feb 2008 17:06
same function, similar structure, all scores good
Domain assignment manual match t by tronnberg on 10 Sep 2007 09:58
SSAP: 81.99 OV: 82 SEQ: 17. Similar linkage and reasonable similar structure. Functionally different.
Homcheck review by tronnberg on 10 Sep 2007 09:58
SSAP: 81.99 OV: 82 SEQ: 17. Similar linkage and reasonable similar structure. Functionally different.
Flow stage update by tronnberg on 10 Sep 2007 09:58
SSAP: 81.99 OV: 82 SEQ: 17. Similar linkage and reasonable similar structure. Functionally different.
Homcheck allotment by tronnberg on 10 Sep 2007 09:54
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 09:54
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 23:37
Domain "2i09A01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 23:33
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2i09A01
Flow stage update by auto on 08 Sep 2007 23:22
Retrieved PRC_PFAMCATH results for job ID SID8404614799842384 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 23:21
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 41 results for 2i09A01
Update comment by auto on 08 Sep 2007 19:18
PRC_PFAMCATH job SID8404614799842384 is not yet finished.
Flow stage update by auto on 08 Sep 2007 19:16
The entry "2i09A01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 08 Sep 2007 19:16
The entry "2i09A01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 18:10
Retrieved SSAP results for job ID SID4193312646634763 and results inserted.
Domain scan ssap cath by auto on 08 Sep 2007 18:09
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 149 results for 2i09A01
Update comment by auto on 05 Sep 2007 19:20
SSAP job SID4193312646634763 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:47
The entry "2i09A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:47
The entry "2i09A01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 06:27
Retrieved PRC results for job ID SID7844031156043200 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 06:26
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2i09A01
Prc cath submit by auto on 05 Sep 2007 03:17
The entry "2i09A01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:17
The entry "2i09A01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 15:18
Retrieved HMM(SAM) results for job ID SID5819315979849376 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 15:17
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2i09A01
Update comment by auto on 04 Sep 2007 11:26
HMM(SAM) job SID5819315979849376 is not yet finished.
Flow stage update by auto on 04 Sep 2007 09:37
The entry "2i09A01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 09:37
The entry "2i09A01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 22:07
Retrieved "2i09A01" CATHEDRAL results for job ID SID0614515191719296 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 22:06
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 478 results for 2i09A01
Flow stage update by auto on 03 Sep 2007 13:45
The entry "2i09A01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:45
The entry "2i09A01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:40
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2i09A01.scanlist" for "2i09A01"
Write scan list by auto on 03 Sep 2007 11:40
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2i09A01.scanlist" for domain "2i09A01"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:13
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:26
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:11
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:12
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:14
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:13
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:30
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:04
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:15
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:35
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:14
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:21
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:27
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:32
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:48
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:10
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:19
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:20
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:12
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:13
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 10:25
Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 06:30
Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 27 Aug 2007 06:28
No satisfactory AssignClose result found.
Flow stage update by auto on 27 Aug 2007 06:12
No in_process hits for Domain "2i09A01" ready to be processed
Flow stage update by auto on 27 Aug 2007 06:12
NW result present for Domain "2i09A01"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2i09A01"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2i09A01"
Insertion by cuff on 18 Aug 2007 13:26
nice chopping
