CATH Domain: 2hxvA02 XML data for domain: 2hxvA02

Molscript image for 2hxvA02
2hxvA02
PDB coordinates for domain 2hxvA02

PDB 2hxv, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.10
3.40.430.10.10.1
3.40.430.10.10.1.1
3.40.430.10.10.1.1.1
3.40.430.10.10.1.1.1.1

[top]
Segment boundaries for domain 2hxvA02

Chopping figure for domain 2hxvA02
DomainStart PDB ResidueStop PDB Residue
2hxvA01 -3 147
2hxvA02 148 345

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.430.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cz3B00 84.12 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 20 80 2.51 3.11
1vdrA00 80.69 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 12 79 3.08 3.89
2p4gA00 80.44 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.430.10 244 15 77 2.83 3.65
1qzfA01 79.87 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 15 80 3.21 3.97
2bl9A00 79.33 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 9 71 2.69 3.75
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hxvA02
PFVALKYASTLDGKIADHRGDSKWITDKLRFKVHERNIYSAVLVGAGTVLKDNPQLTCRLKEGRNPVRVILDRKGVLSGK
VFRVFEENARVIVFTESEEAEYPPHVEKALSDCSVESILRNLYERDIDSVLVEGGSKVFSEFLDHADVVFGFYSTKIFGK
GLDVFSGYLSDVSVPPKFKVVNVEFSDSEFLVERPC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hxvA02
PFVALKYASTLDGKIADHRGDSKWITDKLRFKVHEXRNIYSAVLVGAGTVLKDNPQLTCRLKEGRNPVRVILDRKGVLSG
KVFRVFEENARVIVFTESEEAEYPPHVEKALSDCSVESILRNLYERDIDSVLVEGGSKVFSEFLDHADVVFGFYSTKIFG
KGLDVFSGYLSDVSVPPKFKVVNVEFSDSEFLVEXRPCSRE
BLAST against CATH

[top]
Domain History Events (56)

Domain assigned by cuff on 11 Feb 2008 16:14

def homology

Domain assignment manual match h by cuff on 11 Feb 2008 16:14

same function, nice structural comparison

Domain assignment manual match t by tronnberg on 07 Sep 2007 13:12

SSAP: 84.12 OV: 80 SEQ: 20. Similar linkage and structure. Functionally different.

Homcheck review by tronnberg on 07 Sep 2007 13:12

SSAP: 84.12 OV: 80 SEQ: 20. Similar linkage and structure. Functionally different.

Flow stage update by tronnberg on 07 Sep 2007 13:12

SSAP: 84.12 OV: 80 SEQ: 20. Similar linkage and structure. Functionally different.

Homcheck allotment by tronnberg on 07 Sep 2007 13:08

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 13:08

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 12:12

Domain "2hxvA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 12:11

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hxvA02

Flow stage update by auto on 07 Sep 2007 11:50

Retrieved PRC_PFAMCATH results for job ID SID0718405627301874 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 11:49

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 2hxvA02

Update comment by auto on 07 Sep 2007 09:07

PRC_PFAMCATH job SID0718405627301874 is not yet finished.

Flow stage update by auto on 07 Sep 2007 09:04

The entry "2hxvA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Sep 2007 09:04

The entry "2hxvA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 06:49

Retrieved SSAP results for job ID SID2044853542810704 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 06:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 817 results for 2hxvA02

Update comment by auto on 05 Sep 2007 19:19

SSAP job SID2044853542810704 is not yet finished.

Flow stage update by auto on 05 Sep 2007 15:45

The entry "2hxvA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 15:45

The entry "2hxvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 06:15

Retrieved PRC results for job ID SID1214438283943401 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 06:14

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2hxvA02

Flow stage update by auto on 05 Sep 2007 03:15

The entry "2hxvA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:15

The entry "2hxvA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:07

Retrieved HMM(SAM) results for job ID SID3719997364322080 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:06

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 2hxvA02

Update comment by auto on 04 Sep 2007 11:25

HMM(SAM) job SID3719997364322080 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:36

The entry "2hxvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:36

The entry "2hxvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:55

Retrieved "2hxvA02" CATHEDRAL results for job ID SID2622267923211800 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:54

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 461 results for 2hxvA02

Flow stage update by auto on 03 Sep 2007 13:44

The entry "2hxvA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 13:44

The entry "2hxvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:38

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hxvA02.scanlist" for "2hxvA02"

Write scan list by auto on 03 Sep 2007 11:38

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hxvA02.scanlist" for domain "2hxvA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:11

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:13

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Aug 2007 15:38

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Aug 2007 15:27

No in_process hits for Domain "2hxvA02" ready to be processed

Flow stage update by auto on 30 Aug 2007 15:26

NW result present for Domain "2hxvA02"

Flow stage update by auto on 29 Aug 2007 14:34

All required files are present for Domain "2hxvA02"

Flow stage update by auto on 28 Aug 2007 18:20

Beginning processing for Domain "2hxvA02"

Insertion by cuff on 28 Aug 2007 16:32

nice chopping