Domain assigned by cuff on 11 Feb 2008 15:20
def superfamily match
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.10
| Roll | |
3.10.129
| Thiol Ester Dehydrase; Chain A | |
3.10.129.10
| Gene3D | |
3.10.129.10.3
| ||
3.10.129.10.3.1
| ||
3.10.129.10.3.1.1
| ||
3.10.129.10.3.1.1.1
| ||
3.10.129.10.3.1.1.1.1
|
There are 22 matching structural neighberhood comparisons for CATH ID 3.10.129.10.3.1.1.1.1 (SIMAX score < 5)
>pdb|2hx5A00 NPENWLLLRRVVRFGDTDAAGVHFHQLFRWCHESWEESLESYGLNPADIFPGSRKSEVTPEVALPIIHCQADFRRPIHTG DALAELRPERLNPNSFQVHFEFRCEEQIAAHALIRHLAINAQTRHRCALPEGIDRWLEASG
def superfamily match
SCOP plces these in same family. nice scores throughout
SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.
SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.
SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2hx5A00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hx5A00
Retrieved PRC_PFAMCATH results for job ID SID8653440607799424 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 79 results for 2hx5A00
The entry "2hx5A00" has been submitted to the PRC_PFAMCATH webservice.
The entry "2hx5A00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID8689668735984800 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1340 results for 2hx5A00
SSAP job SID8689668735984800 is not yet finished.
The entry "2hx5A00" has been submitted to the SSAP webservice.
The entry "2hx5A00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID3040029420344768 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 35 results for 2hx5A00
The entry "2hx5A00" has been submitted to the PRC webservice.
The entry "2hx5A00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID8293827163275552 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2hx5A00
HMM(SAM) job SID8293827163275552 is not yet finished.
The entry "2hx5A00" has been submitted to the HMM (SAM) webservice.
The entry "2hx5A00" has been submitted to the HMM (SAM) webservice.
Retrieved "2hx5A00" CATHEDRAL results for job ID SID7066903294715584 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 22 results for 2hx5A00
The entry "2hx5A00" has been submitted to the CATHEDRAL webservice.
The entry "2hx5A00" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hx5A00.scanlist" for "2hx5A00"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hx5A00.scanlist" for domain "2hx5A00"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2hx5A00" ready to be processed
NW result present for Domain "2hx5A00"
All required files are present for Domain "2hx5A00"
Beginning processing for Domain "2hx5A00"
nice chopping