CATH Domain: 2hx5A00 XML data for domain: 2hx5A00

Molscript image for 2hx5A00
2hx5A00
PDB coordinates for domain 2hx5A00

PDB 2hx5, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.129 Thiol Ester Dehydrase; Chain A
3.10.129.10 Gene3D
3.10.129.10.3
3.10.129.10.3.1
3.10.129.10.3.1.1
3.10.129.10.3.1.1.1
3.10.129.10.3.1.1.1.1

Segment boundaries for domain 2hx5A00

Chopping figure for domain 2hx5A00
DomainStart PDB ResidueStop PDB Residue
2hx5A00 2 144

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 3.10.129.10.3.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s5uE00 87.52 Protein bindingEscherichia coli K-12Acyl-CoA thioester hydrolase ybgC 3.10.129.10 136 15 92 2.74 2.95
2o5uC00 87.02 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 140 16 92 3.02 3.28
2oafA00 86.57 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 135 16 90 3.00 3.30
3ck1A00 86.53 Ubiquinone and other terpenoid-quinone biosynthesisRalstonia eutropha JMP1344-hydroxybenzoyl-CoA thioesterase [EC:3.1.2.23]2,4-Dichlorobenzoate degradationMetabolic pathways 3.10.129.10 138 18 91 2.20 2.40
1njkA00 85.45 Long-chain acyl-CoA thioesterase tesCAcyl-CoA thioesterase activityThioesterase III [EC:3.1.2.-]Fatty acid beta-oxidationEscherichia coli K-12 3.10.129.10 130 20 89 2.82 3.16
2aliA00 84.90 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 126 14 85 2.44 2.84
2oiwA00 84.66 Geobacillus kaustophilusHypothetical conserved protein 3.10.129.10 129 15 88 3.04 3.43
2nujA01 84.64 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 145 15 86 2.65 3.05
2hljA01 84.41 Pseudomonas putida KT2440Putative uncharacterized protein 3.10.129.10 132 11 87 3.02 3.43
2essA01 83.59 Bacteroides thetaiotaomicronAcyl-ACP thioesterase 3.10.129.10 138 11 87 2.89 3.31
3bjkD00 82.55 Acyl-CoA thioesterase YciA [EC:3.1.2.-]Haemophilus influenzaeBiosynthesis of unsaturated fatty acidsUncharacterized acyl-CoA thioester hydrolase HI_0827 3.10.129.10 139 13 85 3.71 4.36
1wluA00 81.12 Thermus thermophilus HB8Phenylacetic acid degradation protein PaaIPhenylacetic acid degradation protein 3.10.129.10 117 12 70 3.26 4.60
2pimA00 79.91 Ralstonia eutropha JMP134Phenylacetic acid degradation-related protein 3.10.129.10 127 14 70 3.41 4.86
1q4uB00 79.87 Arthrobacter sp. SUFcbC1 3.10.129.10 139 8 76 3.68 4.80
1tbuB00 79.65 Palmitoyl-CoA hydrolase [EC:3.1.2.2]Protein bindingBiosynthesis of unsaturated fatty acidsPeroxisomal acyl-coenzyme A thioester hydrolase 1Peroxisome 3.10.129.10 98 7 65 3.19 4.89
2q2bA00 79.35 Mus musculusCytosolic acyl coenzyme A thioester hydrolaseFatty acid catabolic processPalmitoyl-CoA hydrolase activity 3.10.129.10 141 11 79 3.91 4.92
3b7kC02 78.96 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 110 13 70 3.29 4.69
1vpmB00 78.70 Acyl-CoA hydrolaseBacillus halodurans 3.10.129.10 148 10 76 3.60 4.72
1zkiA00 77.91 Pseudomonas aeruginosaPhenylacetic acid degradation proteinPutative uncharacterized protein 3.10.129.10 118 14 70 3.34 4.76
1q6wG00 77.08 Monoamine oxidase regulatory protein, putativeArchaeoglobus fulgidus 3.10.129.10 147 10 72 3.58 4.92
2hboA01 76.86 Caulobacter vibrioidesPutative uncharacterized protein 3.10.129.10 126 11 70 3.31 4.71
2qwzA01 76.68 Phenylacetic acid degradation-related proteinRuegeria sp. TM1040 3.10.129.10 128 12 73 3.64 4.98
Displaying entries 1 to 22 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hx5A00
NPENWLLLRRVVRFGDTDAAGVHFHQLFRWCHESWEESLESYGLNPADIFPGSRKSEVTPEVALPIIHCQADFRRPIHTG
DALAELRPERLNPNSFQVHFEFRCEEQIAAHALIRHLAINAQTRHRCALPEGIDRWLEASG    

Domain COMBS Sequence

>pdb|2hx5A00
GXNPENWLLLRRVVRFGDTDAAGVXHFHQLFRWCHESWEESLESYGLNPADIFPGSRKSEVTPEVALPIIHCQADFRRPI
HTGDALAXELRPERLNPNSFQVHFEFRCEEQIAAHALIRHLAINAQTRHRCALPEGIDRWLEASGVGKIGSI    

Domain History Events (55)

Domain assigned by cuff on 11 Feb 2008 15:20

def superfamily match

Domain assignment manual match h by cuff on 11 Feb 2008 15:19

SCOP plces these in same family. nice scores throughout

Domain assignment manual match t by tronnberg on 07 Sep 2007 12:42

SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.

Homcheck review by tronnberg on 07 Sep 2007 12:42

SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.

Flow stage update by tronnberg on 07 Sep 2007 12:42

SSAP: 87.52 OV: 92 SEQ: 15. Similar function and linkage. The query's function is unknown.

Homcheck allotment by tronnberg on 07 Sep 2007 12:39

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 12:39

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 03:31

Domain "2hx5A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 03:30

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hx5A00

Flow stage update by auto on 07 Sep 2007 01:32

Retrieved PRC_PFAMCATH results for job ID SID8653440607799424 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 01:31

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 79 results for 2hx5A00

Prc pfamcath submit by auto on 06 Sep 2007 23:35

The entry "2hx5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 23:35

The entry "2hx5A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 22:37

Retrieved SSAP results for job ID SID8689668735984800 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 22:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1340 results for 2hx5A00

Update comment by auto on 05 Sep 2007 19:18

SSAP job SID8689668735984800 is not yet finished.

Flow stage update by auto on 05 Sep 2007 15:45

The entry "2hx5A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 15:45

The entry "2hx5A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 06:10

Retrieved PRC results for job ID SID3040029420344768 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 06:09

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 35 results for 2hx5A00

Prc cath submit by auto on 05 Sep 2007 03:14

The entry "2hx5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 03:14

The entry "2hx5A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 15:02

Retrieved HMM(SAM) results for job ID SID8293827163275552 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 15:01

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 12 results for 2hx5A00

Update comment by auto on 04 Sep 2007 11:25

HMM(SAM) job SID8293827163275552 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:35

The entry "2hx5A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:35

The entry "2hx5A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:50

Retrieved "2hx5A00" CATHEDRAL results for job ID SID7066903294715584 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:49

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 22 results for 2hx5A00

Cathedral cath submit by auto on 03 Sep 2007 13:43

The entry "2hx5A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:43

The entry "2hx5A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:38

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hx5A00.scanlist" for "2hx5A00"

Write scan list by auto on 03 Sep 2007 11:37

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hx5A00.scanlist" for domain "2hx5A00"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:26

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:30

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Aug 2007 15:38

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Aug 2007 15:27

No in_process hits for Domain "2hx5A00" ready to be processed

Flow stage update by auto on 30 Aug 2007 15:26

NW result present for Domain "2hx5A00"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2hx5A00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2hx5A00"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping