CATH Domain: 2hwjA02 XML data for domain: 2hwjA02

Molscript image for 2hwjA02
2hwjA02
PDB coordinates for domain 2hwjA02

PDB 2hwj, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.12
1.10.8.10.12.1
1.10.8.10.12.1.1
1.10.8.10.12.1.1.1
1.10.8.10.12.1.1.1.1

[top]
Segment boundaries for domain 2hwjA02

Chopping figure for domain 2hwjA02
DomainStart PDB ResidueStop PDB Residue
2hwjA01 4 134
2hwjA02 135 195

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.10.8.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ixrB03 78.79 Homologous recombinationThermus thermophilus HB8Holliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAProtein binding 1.10.8.10 53 15 76 3.24 4.25
1pjqA03 78.05 Porphyrin and chlorophyll metabolismSalmonella enterica subsp. enterica serovar TyphimuriumSiroheme synthaseUroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]Metabolic pathways 1.10.8.210 65 13 87 4.23 4.82
1s26D01 77.15 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 8 83 3.30 3.97
1ifyA00 77.11 Nucleotide excision repairNucleotide-excision repairUV excision repair protein RAD23 homolog ASingle-stranded DNA bindingHomo sapiens 1.10.8.10 49 6 71 3.05 4.28
1i2tA00 76.06 Progesterone receptor signaling pathwayE3 ubiquitin-protein ligase EDD1 [EC:6.3.2.19]NucleusSoluble fractionUbiquitin mediated proteolysis 1.10.1900.10 61 13 81 3.22 3.93
1no1A00 75.72 39 proteinBacillus phage SPP1 1.10.8.200 65 6 66 3.02 4.57
3bosA02 73.52 DnaA-homolog proteinShewanella amazonensis SB2BRegulatory inactivation of DnaA Hda protein 1.10.8.60 59 10 74 3.62 4.85
1qyrA02 73.08 Ribosomal RNA small subunit methyltransferase ARRNA bindingRibosomal small subunit assemblyRRNA (adenine-N6,N6-)-dimethyltransferase activityMRNA binding 1.10.8.100 68 8 50 2.47 4.94
1tteA02 73.07 Ubiquitin-conjugating enzyme E2-24 kDaIdentical protein bindingProtein polyubiquitinationUbiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19]Ubiquitin mediated proteolysis 1.10.8.10 57 7 72 3.22 4.42
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hwjA02
PFRSLAGALRAGGYAKVIIPFSEFGWADFLRRRIDRDLLSDSFDDALAEAKLAKSREAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hwjA02
PFRSLAGALRXAGGYAKVIIPFSEFGWADFLRRRIDRDLLSDSFDDALAEAXKLAKSREAR
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 12 Feb 2008 20:21

Assigning to "1.10.8.10" based on similarity with "2hwjD02"

Flow stage update by auto on 12 Feb 2008 20:19

No in_process hits for Domain "2hwjA02" ready to be processed

Update comment by auto on 12 Feb 2008 20:16

Domain "2hwjA02" hits Domain "2hwjD02" (96.7213114754098% over 100%) which is currently in process

Update comment by auto on 12 Feb 2008 20:04

Domain "2hwjA02" hits Domain "2hwjE02" (96.7213114754098% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2hwjA02" hits Domain "2hwjF02" (96.7213114754098% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hwjA02" hits Domain "2hwjF02" (96.7213114754098% over 100%) which is currently in process

Update comment by auto on 27 Aug 2007 02:10

Domain "2hwjA02" hits Domain "2hwjF02" (96.7213114754098% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 02:09

Domain "2hwjA02" hits Domain "2hwjF02" (96.7213114754098% over 100%) which is currently in process

Flow stage update by auto on 27 Aug 2007 02:09

NW result present for Domain "2hwjA02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2hwjA02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2hwjA02"

Insertion by auto on 18 Aug 2007 14:14

Final ChopClose added based on similarity with "2hwjB"