CATH Domain: 2hufA02 XML data for domain: 2hufA02

Molscript image for 2hufA02
2hufA02
PDB coordinates for domain 2hufA02

PDB 2huf, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.640 Aspartate Aminotransferase; domain 2
3.40.640.10 Type I PLP-dependent aspartate aminotransferase-like (Major domain) Gene3D
3.40.640.10.7
3.40.640.10.7.2
3.40.640.10.7.2.1
3.40.640.10.7.2.1.1
3.40.640.10.7.2.1.1.1

Segment boundaries for domain 2hufA02

Chopping figure for domain 2hufA02
DomainStart PDB ResidueStop PDB Residue
2hufA01 1 30
2hufA01 280 385
2hufA02 31 279

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 3.40.640.10.7.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2yrrA02 89.26 Thermus thermophilus HB8Aminotransferase, class V 3.40.640.10 241 32 90 1.46 1.62
1m32A02 85.24 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.40.640.10 237 22 91 2.36 2.59
1p3wA02 81.24 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.40.640.10 247 16 83 2.87 3.42
1bs0A02 80.51 Biotin metabolismMetabolic pathways8-amino-7-oxononanoate synthase [EC:2.3.1.47]8-amino-7-oxononanoate synthase activityBiotin biosynthetic process 3.40.640.10 228 11 86 3.52 4.07
1t3iB02 80.26 Cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]Probable cysteine desulfuraseThiamine metabolismSelenoamino acid metabolismMetabolic pathways 3.40.640.10 258 13 82 3.46 4.21
1eluA02 80.08 Synechocystis sp. PCC 6714L-cysteine/cystine lyase C-DES 3.40.640.10 264 14 79 3.22 4.03
1lc5A02 79.88 Porphyrin and chlorophyll metabolismSalmonella enterica subsp. enterica serovar TyphimuriumThreonine-phosphate decarboxylaseThreonine-phosphate decarboxylase [EC:4.1.1.81] 3.40.640.10 225 11 84 3.28 3.88
1fc4A01 79.69 Glycine, serine and threonine metabolismMetal ion bindingLigase activity2-amino-3-ketobutyrate coenzyme A ligaseGlycine C-acetyltransferase [EC:2.3.1.29] 3.40.640.10 230 12 84 3.70 4.39
1jg8A01 78.39 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.40.640.10 245 11 82 3.93 4.74
1o4sA02 78.14 Tyrosine metabolismThermotoga maritimaArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Metabolic pathways 3.40.640.10 221 14 81 3.84 4.74
1c7nA02 78.07 Treponema denticolaHemolysin 3.40.640.10 225 8 83 3.84 4.61
1xi9A02 77.69 Pyrococcus furiosusAminotransferase [EC:2.6.1.-]Alanine aminotransferase 3.40.640.10 242 8 81 3.85 4.71
3ffhB02 77.16 Tyrosine metabolismListeria innocuaHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.40.640.10 208 8 82 3.98 4.83
1d2fA02 77.01 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.40.640.10 243 11 81 3.94 4.81
1gd9A02 76.74 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Pyrococcus horikoshiiMetabolic pathways 3.40.640.10 223 11 82 3.75 4.55
3dydA02 76.72 Tyrosine metabolismL-tyrosine:2-oxoglutarate aminotransferase activityPhenylalanine metabolismMetabolic pathwaysUbiquinone and other terpenoid-quinone biosynthesis 3.40.640.10 244 11 81 3.86 4.71
2ez2A02 76.66 Citrobacter freundiiTyrosine phenol-lyase 3.40.640.10 253 9 77 3.39 4.35
2qmaA03 76.57 Diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]Vibrio parahaemolyticusGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylaseMetabolic pathways 3.40.640.10 238 9 77 3.17 4.10
3ftbA02 76.43 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismPhenylalanine metabolismMetabolic pathways 3.40.640.10 222 6 84 3.55 4.22
1svvA01 76.15 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.40.640.10 242 9 82 3.93 4.78
3k40A02 75.90 Dopamine biosynthetic process from tyrosineDevelopmental pigmentationGrowthProtein bindingDrosophila melanogaster 3.40.640.10 267 8 71 3.20 4.45
1uu1A02 75.70 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.40.640.10 203 8 78 3.72 4.72
Displaying entries 1 to 22 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hufA02
PQRVLDAMSRPILGHLHPETLKIMDDIKEGVRYLFQTNNIATFCLSASGHGGMEATLCNLLEDGDVILIGHTGHWGDRSA
DMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLGGAPM
FMDRWEIDAMYTGSQVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDMSLVGDYWGCFGRPRIYHHTISSTLLYGLRE
AIAMACEE    

Domain COMBS Sequence

>pdb|2hufA02
PQRVLDAMSRPILGHLHPETLKIMDDIKEGVRYLFQTNNIATFCLSASGHGGMEATLCNLLEDGDVILIGHTGHWGDRSA
DMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLGGAPM
FMDRWEIDAMYTGSQXVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDMSLVGDYWGCFGRPRIYHHTISSTLLYGLR
EAIAMACEE    

Domain History Events (14)

Domain assigned by auto on 15 Aug 2007 05:16

Assigning to "3.40.640.10" based on similarity with "2huiB02"

Flow stage update by auto on 15 Aug 2007 05:07

No in_process hits for Domain "2hufA02" ready to be processed

Update comment by auto on 15 Aug 2007 04:35

Domain "2hufA02" hits Domain "2ch1B02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:01

Domain "2hufA02" hits Domain "2ch1D02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:21

Domain "2hufA02" hits Domain "2ch2B02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:39

Domain "2hufA02" hits Domain "2ch1C02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:38

Domain "2hufA02" hits Domain "2ch2D02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2hufA02" hits Domain "2ch2C02" (55.0200803212851% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2hufA02" hits Domain "2ch2A02" (55.0200803212851% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

Domain "2hufA02" hits Domain "2huiB02" (99.5983935742972% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

NW result present for Domain "2hufA02"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hufA02"

Flow stage update by auto on 15 Jul 2007 19:15

Beginning processing for Domain "2hufA02"

Insertion by auto on 15 Jul 2007 18:21

Final ChopClose added based on similarity with "2hufB"