CATH Domain: 2hufA01 XML data for domain: 2hufA01

Molscript image for 2hufA01
2hufA01
PDB coordinates for domain 2hufA01

PDB 2huf, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.3
3.90.1150.10.3.2
3.90.1150.10.3.2.1
3.90.1150.10.3.2.1.1
3.90.1150.10.3.2.1.1.1

Segment boundaries for domain 2hufA01

Chopping figure for domain 2hufA01
DomainStart PDB ResidueStop PDB Residue
2hufA01 1 30
2hufA01 280 385
2hufA02 31 279

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.3.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1iugA01 84.20 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 25 79 1.86 2.34
1m32A01 83.21 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 21 79 2.88 3.63
1eg5B01 81.53 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 19 74 2.98 4.02
3ftbA01 81.26 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 8 77 2.79 3.62
1p3wA01 78.69 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 9 74 2.84 3.80
2qmaA02 78.60 Diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]Vibrio parahaemolyticusGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylaseMetabolic pathways 3.90.1150.10 122 6 82 3.31 4.01
1uu2B01 78.15 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 10 73 3.17 4.33
3k40A03 77.50 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 8 67 2.96 4.41
1jg8A02 76.75 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 6 67 3.22 4.79
1o69A02 76.64 Campylobacter jejuniAminotransferase homolog 3.90.1150.10 141 6 65 2.88 4.37
1c4kA03 73.28 Lactobacillus sp. 30AOrnithine decarboxylase, inducible 3.90.1150.10 180 10 52 2.59 4.96
Displaying entries 1 to 11 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hufA01
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGVDWL
KAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKP    

Domain COMBS Sequence

>pdb|2hufA01
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGVDWL
KAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKPDVQVKGKM    

Domain History Events (14)

Domain assigned by auto on 15 Aug 2007 05:16

Assigning to "3.90.1150.10" based on similarity with "2huiA01"

Flow stage update by auto on 15 Aug 2007 05:07

No in_process hits for Domain "2hufA01" ready to be processed

Update comment by auto on 15 Aug 2007 04:35

Domain "2hufA01" hits Domain "2ch1A01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 04:01

Domain "2hufA01" hits Domain "2ch2C01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 03:21

Domain "2hufA01" hits Domain "2ch2A01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 02:39

Domain "2hufA01" hits Domain "2ch2D01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 01:38

Domain "2hufA01" hits Domain "2ch1C01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2hufA01" hits Domain "2ch1D01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2hufA01" hits Domain "2ch2B01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

Domain "2hufA01" hits Domain "2huiB01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

NW result present for Domain "2hufA01"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hufA01"

Flow stage update by auto on 15 Jul 2007 19:15

Beginning processing for Domain "2hufA01"

Insertion by auto on 15 Jul 2007 18:21

Final ChopClose added based on similarity with "2hufB"