CATH Domain: 2hufA01 XML data for domain: 2hufA01

Molscript image for 2hufA01
2hufA01
PDB coordinates for domain 2hufA01

PDB 2huf, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.6
3.90.1150.10.6.1
3.90.1150.10.6.1.1
3.90.1150.10.6.1.1.1
3.90.1150.10.6.1.1.1.1

Segment boundaries for domain 2hufA01

Chopping figure for domain 2hufA01
DomainStart PDB ResidueStop PDB Residue
2hufA01 1 30
2hufA01 280 385
2hufA02 31 279

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1m32A01 85.81 2-aminoethylphosphonate--pyruvate transaminaseAminophosphonate metabolism2-aminoethylphosphonate-pyruvate transaminaseSalmonella typhimurium 3.90.1150.10 110 21 78 1.68 2.14
1iugA01 84.50 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 24 79 2.06 2.59
1p3wA01 81.91 Thiamine metabolismCysteine desulfuraseCysteine desulfuraseEscherichia coli K12Protein binding 3.90.1150.10 121 13 78 2.82 3.58
1w23A02 81.38 Phosphoserine aminotransferaseBacillus alcalophilus 3.90.1150.10 103 11 74 3.06 4.12
1eg5B01 81.29 Thermotoga maritimaCysteine desulfuraseThiamine metabolismAminotransferase, class V 3.90.1150.10 106 16 72 2.50 3.47
1uu2B01 80.36 Histidinol-phosphate aminotransferaseTyrosine metabolismThermotoga maritimaNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesis 3.90.1150.10 117 9 73 2.66 3.62
2qmaA02 79.70 Vibrio parahaemolyticusDiaminobutyrate-2-oxoglutarate transaminaseGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylase 3.90.1150.10 122 6 80 3.23 3.99
1b9hA02 79.59 Amycolatopsis mediterraneiRifK 3.90.1150.10 139 8 74 3.22 4.35
1mdoA02 78.91 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferaseUDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferaseNucleotide sugars metabolismTwo-component system - GeneralSalmonella typhimurium 3.90.1150.10 123 13 70 2.60 3.68
1js3A03 78.84 Tyrosine metabolismSus scrofaAromatic-L-amino-acid decarboxylaseAromatic-L-amino-acid decarboxylaseHistidine metabolism 3.90.1150.10 97 9 66 2.51 3.75
1jg8A02 78.68 Thermotoga maritimaGlycine, serine and threonine metabolismThreonine aldolaseL-allo-threonine aldolase 3.90.1150.10 96 8 67 2.53 3.74
1svvB02 78.59 Leishmania major strain FriedlinGlycine, serine and threonine metabolismThreonine aldolasePutative uncharacterized protein 3.90.1150.10 88 17 64 3.21 4.96
3b8xA02 77.57 Putative pyridoxamine 5-phosphate-dependent dehydraseEscherichia coli 3.90.1150.10 124 8 70 2.39 3.39
Displaying entries 1 to 13 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hufA01
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGVDWL
KAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKP    

Domain COMBS Sequence

>pdb|2hufA01
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGVDWL
KAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKPDVQVKGKM    

Domain History Events (14)

Domain assigned by auto on 15 Aug 2007 05:16

Assigning to "3.90.1150.10" based on similarity with "2huiA01"

Flow stage update by auto on 15 Aug 2007 05:07

No in_process hits for Domain "2hufA01" ready to be processed

Update comment by auto on 15 Aug 2007 04:35

Domain "2hufA01" hits Domain "2ch1A01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 04:01

Domain "2hufA01" hits Domain "2ch2C01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 03:21

Domain "2hufA01" hits Domain "2ch2A01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 02:39

Domain "2hufA01" hits Domain "2ch2D01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 01:38

Domain "2hufA01" hits Domain "2ch1C01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2hufA01" hits Domain "2ch1D01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2hufA01" hits Domain "2ch2B01" (44.4444444444444% over 97.2789115646258%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

Domain "2hufA01" hits Domain "2huiB01" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

NW result present for Domain "2hufA01"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hufA01"

Flow stage update by auto on 15 Jul 2007 19:15

Beginning processing for Domain "2hufA01"

Insertion by auto on 15 Jul 2007 18:21

Final ChopClose added based on similarity with "2hufB"