CATH Domain: 2hueB00 XML data for domain: 2hueB00

Molscript image for 2hueB00
2hueB00
PDB coordinates for domain 2hueB00

PDB 2hue, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.20 Histone, subunit A
1.10.20.10 Histone, subunit A Gene3D
1.10.20.10.8
1.10.20.10.8.1
1.10.20.10.8.1.1
1.10.20.10.8.1.1.1
1.10.20.10.8.1.1.1.1

[top]
Segment boundaries for domain 2hueB00

Chopping figure for domain 2hueB00
DomainStart PDB ResidueStop PDB Residue
2hueB00 60 134

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 1.10.20.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h3oB00 90.52 General RNA polymerase II transcription factor activityTranscription initiation factor TFIID subunit 12STAGA complexHistone H3 acetylationPlasma membrane 1.10.20.10 71 12 93 1.93 2.07
1b67A00 90.39 Methanothermus fervidusDNA-binding protein HMf-1 1.10.20.10 68 26 90 1.52 1.68
1tafB00 89.74 Transcription initiation factor TFIID subunit D5Transcription factor TFIID complexTranscription initiation factor TFIID subunit 6Drosophila melanogasterProtein binding 1.10.20.10 69 18 86 1.66 1.92
1tafA00 88.93 Transcription factor TFIID complexSAGA complexTranscription initiation factor TFIID subunit D7Transcription initiation factor TFIID subunit 9Drosophila melanogaster 1.10.20.10 67 20 89 1.65 1.85
1bh9B00 87.22 Protein N-terminus bindingThyroid hormone receptor bindingTranscription coactivator activityBasal transcription factorsPositive regulation by host of viral transcription 1.10.20.10 89 16 78 2.09 2.66
1jfiA00 86.78 Sequence-specific DNA binding transcription factor activityTranscription corepressor activityHomo sapiensNegative regulation of transcription from RNA polymerase II promoterDr1-associated corepressor 1.10.20.10 63 11 84 2.22 2.64
1kx5A00 83.18 Systemic lupus erythematosusHistone H3.2Xenopus laevisHistone H3 1.10.20.10 135 98 55 0.97 1.75
1h3oA00 81.60 General RNA polymerase II transcription factor activityTranscription coactivator activityBasal transcription factorsTranscription factor TFIID complexCytoplasm 1.10.20.10 48 20 64 1.68 2.62
1kx5D00 81.50 Histone H2BXenopus laevisHistone H2B 1.1 1.10.20.10 122 17 58 1.67 2.87
1jfiB00 77.69 Protein Dr1Transcription corepressor activityHomo sapiensNegative regulation of transcription from RNA polymerase II promoter 1.10.20.10 135 12 53 1.82 3.41
1f1eA00 74.91 Methanopyrus kandleriHistone H3/H4 1.10.20.10 147 16 47 2.27 4.77
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hueB00
ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hueB00
MALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 10 Dec 2008 21:39

Assigning to "1.10.20.10" based on similarity with "2hioC00"

Flow stage update by auto on 10 Dec 2008 21:34

No in_process hits for Domain "2hueB00" ready to be processed

Update comment by auto on 10 Dec 2008 21:15

Domain "2hueB00" hits Domain "3b6fE00" (97.4025974025974% over 73.3333333333333%) which is currently in process

Update comment by auto on 10 Dec 2008 20:49

Domain "2hueB00" hits Domain "3b6gE00" (97.4025974025974% over 73.3333333333333%) which is currently in process

Update comment by auto on 10 Dec 2008 20:30

Domain "2hueB00" hits Domain "3b6fA00" (97.4025974025974% over 74.7572815533981%) which is currently in process

Update comment by auto on 10 Dec 2008 14:33

Domain "2hueB00" hits Domain "3b6gA00" (97.4025974025974% over 74.7572815533981%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:18

Domain "2hueB00" hits Domain "3b6gA00" (97.4025974025974% over 74.7572815533981%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2hueB00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2hueB00"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2hueB00"

Insertion by cuff on 05 Dec 2008 16:57

WCD