CATH Domain: 2hszA02 XML data for domain: 2hszA02

Molscript image for 2hszA02
2hszA02
PDB coordinates for domain 2hszA02

PDB 2hsz, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.5
1.10.150.240.5.1
1.10.150.240.5.1.1
1.10.150.240.5.1.1.1
1.10.150.240.5.1.1.1.1

Segment boundaries for domain 2hszA02

Chopping figure for domain 2hszA02
DomainStart PDB ResidueStop PDB Residue
2hszA01 0 18
2hszA01 94 224
2hszA02 19 93

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 1.10.150.240.5.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1swvA02 86.56 Bacillus cereusPhosphonoacetaldehyde hydrolase 1.10.150.240 78 6 89 2.31 2.57
2hi0A02 86.46 Putative phosphoglycolate phosphatasePhosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842Metabolic pathwaysGlyoxylate and dicarboxylate metabolism 1.10.150.240 86 20 82 3.51 4.25
2nyvA02 85.86 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 21 83 2.42 2.90
3dv9A02 84.20 Bacteroides vulgatus ATCC 8482Putative beta-phosphoglucomutase 1.10.150.240 64 9 87 2.79 3.19
2hcfA02 83.07 Chlorobaculum tepidumHydrolase, haloacid dehalogenase-like family 1.10.150.240 63 12 83 2.93 3.52
2fdrA02 82.39 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 1.10.150.240 64 6 84 2.54 3.00
1te2A02 81.64 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 1.10.150.240 70 8 77 3.78 4.86
3ed5A02 80.67 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 1.10.150.240 79 6 77 3.19 4.13
2ah5A02 80.60 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 7 84 2.72 3.21
2px6A02 80.58 Insulin signaling pathwayFatty acid biosynthesisFatty acid synthaseProtein bindingMetabolic pathways 1.10.1470.20 73 6 86 3.44 3.99
3b40A02 80.27 Pseudomonas aeruginosaProbable dipeptidase 1.10.287.650 58 6 73 3.66 4.97
3e58A02 79.44 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 1.10.150.240 62 3 79 2.88 3.64
1u84A00 79.16 Geobacillus kaustophilusHypothetical conserved protein 1.10.340.20 81 6 86 3.90 4.51
2qltA02 73.51 Response to osmotic stressNucleusProtein bindingMetabolic pathwaysCytoplasm 1.10.150.240 60 13 83 4.02 4.82
Displaying entries 1 to 14 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hszA02
LPDLALSINSALKDVNLPQASENLVTWIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNI    

Domain COMBS Sequence

>pdb|2hszA02
LPDLALSINSALKDVNLPQASENLVXTWIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNI    

Domain History Events (12)

Domain assigned by auto on 11 Feb 2008 14:14

Assigning to "1.10.150.240" based on similarity with "2hszB02"

Flow stage update by auto on 11 Feb 2008 14:04

No in_process hits for Domain "2hszA02" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2hszA02" hits Domain "2hszB02" (98.6666666666667% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hszA02"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hszA02"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hszA02"

Insertion by auto on 06 Jul 2007 14:03

Final ChopClose added based on similarity with "2hszB"