CATH Domain: 2hsjD00 XML data for domain: 2hsjD00

Molscript image for 2hsjD00
2hsjD00
PDB coordinates for domain 2hsjD00

PDB 2hsj, Chain D, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1110 Gene3D
3.40.50.1110.4
3.40.50.1110.4.1
3.40.50.1110.4.1.1
3.40.50.1110.4.1.1.1
3.40.50.1110.4.1.1.1.1

[top]
Segment boundaries for domain 2hsjD00

Chopping figure for domain 2hsjD00
DomainStart PDB ResidueStop PDB Residue
2hsjD00 -2 211

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.1110.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1yzfA00 83.84 Lipase/acylhydrolaseEnterococcus faecalis 3.40.50.1110 195 20 79 2.49 3.12
1z8hA00 83.47 Nostoc sp. PCC 7120Alr1529 protein 3.40.50.1110 197 16 80 3.66 4.56
3hp4A00 80.25 Pseudoalteromonas sp. 643AGDSL-esterase 3.40.50.1110 168 18 69 3.06 4.38
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hsjD00
SNAAVQLLENWLLKEQEKIQTKYRHLNHISVVEPNILFIGDSIVEYYPLQELFGTSKTIVNRGIRGYQTGLLLENLDAHL
YGGAVDKIFLLIGTNDIGKDVPVNEALNNLEAIIQSVARDYPLTEIKLLSILPVNEREEYQQAVYIRSNEKIQNWNQAYQ
ELASAYQVEFVPVFDCLTDQAGQLKKEYTTDGLHLSIAGYQALSKSLKDYLY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hsjD00
SNAXAVQLLENWLLKEQEKIQTKYRHLNHISVVEPNILFIGDSIVEYYPLQELFGTSKTIVNRGIRGYQTGLLLENLDAH
LYGGAVDKIFLLIGTNDIGKDVPVNEALNNLEAIIQSVARDYPLTEIKLLSILPVNEREEYQQAVYIRSNEKIQNWNQAY
QELASAYXQVEFVPVFDCLTDQAGQLKKEYTTDGLHLSIAGYQALSKSLKDYLY
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 11 Feb 2008 17:21

Assigning to "3.40.50.1110" based on similarity with "2hsjA00"

Flow stage update by auto on 11 Feb 2008 17:19

No in_process hits for Domain "2hsjD00" ready to be processed

Update comment by auto on 11 Feb 2008 17:06

Domain "2hsjD00" hits Domain "2hsjB00" (99.0654205607477% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2hsjD00" hits Domain "2hsjA00" (99.0654205607477% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hsjD00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hsjD00"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hsjD00"

Insertion by cuff on 06 Jul 2007 13:51

nice chopping