CATH Domain: 2hs1A00

2hs1A00

PDB 2hs1, Chain A, Domain 0

CATH Code	Level Description	Links
2	Mainly Beta
2.40	Beta Barrel
2.40.70	Cathepsin D, subunit A; domain 1
2.40.70.10	Acid Proteases	Gene3D
2.40.70.10.4
2.40.70.10.4.1
2.40.70.10.4.1.1
2.40.70.10.4.1.1.1
2.40.70.10.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2hs1A00

Domain	Start PDB Residue	Stop PDB Residue
2hs1A00	1	99

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.40.70.10.4.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1fmbA00	89.44	Equine infectious anemia virus (clone CL22)Pol polyprotein	2.40.70.10	104	32	94	1.72	1.83
2hahA00	88.71	Pol polyproteinFeline immunodeficiency virus (isolate Petaluma)	2.40.70.10	112	38	86	1.60	1.85
2rspA00	85.86	Rous sarcoma virus - Prague CGag polyprotein	2.40.70.10	115	26	80	1.79	2.24
2pmaA01	79.75	Legionella pneumophila subsp. pneumophila str. Philadelphia 1Putative uncharacterized protein	2.40.70.10	117	13	74	2.89	3.89
1nsoA00	75.57	ProteaseMason-Pfizer monkey virus	2.40.70.10	107	22	88	4.37	4.92

[top]
Domain ATOM Sequence

>pdb|2hs1A00
PQITLWKRPLVTIKIGGQLKEALLDTGADDTIIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT
PVNIIGRNLLTQIGATLNF

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2hs1A00
PQITLWKRPLVTIKIGGQLKEALLDTGADDTIIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT
PVNIIGRNLLTQIGATLNF

BLAST against CATH

[top]
Domain History Events (33)

Domain assigned by auto on 05 Nov 2006 09:29

Assigning to "2.40.70.10" based on similarity with "2hs1B00"

Flow stage update by auto on 05 Nov 2006 09:24

No in_process hits for Domain "2hs1A00" ready to be processed

Update comment by auto on 05 Nov 2006 05:23

Domain "2hs1A00" hits Domain "2hs1B00" (100% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 01:36

Domain "2hs1A00" hits Domain "2hb3B00" (98.989898989899% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 21:25

Domain "2hs1A00" hits Domain "2hb3A00" (98.989898989899% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 17:26

Domain "2hs1A00" hits Domain "2g69A00" (97.979797979798% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 14:53

Domain "2hs1A00" hits Domain "2fntB00" (88.8888888888889% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 10:03

Domain "2hs1A00" hits Domain "2fntA00" (88.8888888888889% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 06:17

Domain "2hs1A00" hits Domain "2fnsA00" (89.8989898989899% over 100%) which is currently in process

Update comment by auto on 04 Nov 2006 02:33

Domain "2hs1A00" hits Domain "2fnsB00" (89.8989898989899% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 22:56

Domain "2hs1A00" hits Domain "2aquA00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 17:53

Domain "2hs1A00" hits Domain "2aquB00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 13:58

Domain "2hs1A00" hits Domain "1zsrB00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 10:27

Domain "2hs1A00" hits Domain "1zsrA00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 06:13

Domain "2hs1A00" hits Domain "1zsfB00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 02:18

Domain "2hs1A00" hits Domain "1zsfA00" (93.9393939393939% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 22:11

Domain "2hs1A00" hits Domain "1zpkA00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 18:15

Domain "2hs1A00" hits Domain "1zpkB00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 14:26

Domain "2hs1A00" hits Domain "1zlfB00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 10:07

Domain "2hs1A00" hits Domain "1zlfA00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:13

Domain "2hs1A00" hits Domain "1zj7A00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2hs1A00" hits Domain "1zbgB00" (90.9090909090909% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:57

Domain "2hs1A00" hits Domain "1zbgA00" (90.9090909090909% over 100%) which is currently in process