Domain assigned by cuff on 20 Feb 2008 14:30
same superfamily
CATH Domain: 2hrzA02
2hrzA02
PDB 2hrz, Chain A, Domain 2
Segment boundaries for domain 2hrzA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hrzA01 | 8 | 186 |
| 2hrzA01 | 232 | 259 |
| 2hrzA01 | 292 | 314 |
| 2hrzA02 | 187 | 231 |
| 2hrzA02 | 260 | 290 |
| 2hrzA02 | 315 | 336 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2hrzA02 PTICIRPGKPNAAASGFFSNILREPLVGQEAVLPVPESIRHWHASGLSATVGEQIEALRKVAGEKAVALIRREPNEAESS FEEIIQVHIEDELGGSLK
Domain History Events (44)
Domain assignment manual match h by cuff on 20 Feb 2008 14:28
same family in scop, same superfamily in CATH
Domain assignment manual match t by rupa on 07 Sep 2007 12:21
Good ssap score, same fold. Unknown function.
Homcheck review by rupa on 07 Sep 2007 12:21
Good ssap score, same fold. Unknown function.
Flow stage update by rupa on 07 Sep 2007 12:21
Good ssap score, same fold. Unknown function.
Homcheck allotment by rupa on 07 Sep 2007 12:02
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 07 Sep 2007 12:02
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 07 Sep 2007 03:19
Domain "2hrzA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 07 Sep 2007 03:18
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hrzA02
Flow stage update by auto on 07 Sep 2007 01:19
Retrieved PRC_PFAMCATH results for job ID SID6558028192021248 and results inserted.
Domain scan prc pfamcath by auto on 07 Sep 2007 01:18
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hrzA02
Update comment by auto on 06 Sep 2007 16:15
PRC_PFAMCATH job SID6558028192021248 is not yet finished.
Prc pfamcath submit by auto on 06 Sep 2007 16:08
The entry "2hrzA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Sep 2007 16:08
The entry "2hrzA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Sep 2007 15:04
Retrieved SSAP results for job ID SID4825702673272128 and results inserted.
Domain scan ssap cath by auto on 06 Sep 2007 15:01
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1870 results for 2hrzA02
Update comment by auto on 05 Sep 2007 19:17
SSAP job SID4825702673272128 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:44
The entry "2hrzA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:44
The entry "2hrzA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 06:01
Retrieved PRC results for job ID SID1861781249789576 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 06:00
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hrzA02
Prc cath submit by auto on 05 Sep 2007 03:13
The entry "2hrzA02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:13
The entry "2hrzA02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 14:53
Retrieved HMM(SAM) results for job ID SID9989401073390608 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 14:52
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hrzA02
Update comment by auto on 04 Sep 2007 11:24
HMM(SAM) job SID9989401073390608 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:34
The entry "2hrzA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:34
The entry "2hrzA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 21:40
Retrieved "2hrzA02" CATHEDRAL results for job ID SID7569958083261728 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 21:39
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 91 results for 2hrzA02
Cathedral cath submit by auto on 03 Sep 2007 13:43
The entry "2hrzA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:43
The entry "2hrzA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:36
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hrzA02.scanlist" for "2hrzA02"
Write scan list by auto on 03 Sep 2007 11:36
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hrzA02.scanlist" for domain "2hrzA02"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 02 Sep 2007 22:29
No satisfactory AssignClose result found.
Flow stage update by auto on 02 Sep 2007 22:22
No in_process hits for Domain "2hrzA02" ready to be processed
Flow stage update by auto on 02 Sep 2007 22:22
NW result present for Domain "2hrzA02"
Flow stage update by auto on 01 Sep 2007 14:04
All required files are present for Domain "2hrzA02"
Flow stage update by auto on 31 Aug 2007 19:47
Beginning processing for Domain "2hrzA02"
Insertion by cuff on 31 Aug 2007 13:23
nice chopping
