CATH Domain: 2hrcA02 XML data for domain: 2hrcA02

Molscript image for 2hrcA02
2hrcA02
PDB coordinates for domain 2hrcA02

PDB 2hrc, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1400 Gene3D
3.40.50.1400.3
3.40.50.1400.3.1
3.40.50.1400.3.1.1
3.40.50.1400.3.1.1.1
3.40.50.1400.3.1.1.1.3

[top]
Segment boundaries for domain 2hrcA02

Chopping figure for domain 2hrcA02
DomainStart PDB ResidueStop PDB Residue
2hrcA01 65 227
2hrcA01 371 423
2hrcA02 228 370

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1400.3.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qgoA02 77.71 Porphyrin and chlorophyll metabolismMetabolic pathwaysSirohydrochlorin cobaltochelataseSalmonella enterica subsp. enterica serovar TyphimuriumSirohydrochlorin cobaltochelatase [EC:4.99.1.3] 3.40.50.1400 134 5 71 3.38 4.74
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hrcA02
PTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGP
MPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAES
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hrcA02
PTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGP
MPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAES
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:47

Assigning to "3.40.50.1400" based on similarity with "2hrcB02"

Flow stage update by auto on 15 Aug 2007 00:07

No in_process hits for Domain "2hrcA02" ready to be processed

Update comment by auto on 14 Aug 2007 22:50

Domain "2hrcA02" hits Domain "2hrcB02" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

Domain "2hrcA02" hits Domain "2hreB02" (99.3006993006993% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 14:34

NW result present for Domain "2hrcA02"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hrcA02"

Flow stage update by auto on 14 Jul 2007 23:03

Beginning processing for Domain "2hrcA02"

Insertion by auto on 14 Jul 2007 22:19

Final ChopClose added based on similarity with "1hrkA"