Domain assigned by auto on 14 Jan 2008 17:17
Assigning to "1.25.40.10" based on similarity with "2hr2F00"
There are 3 matching structural neighberhood comparisons for CATH ID 1.25.40.10.11.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2fo7A00 | 83.84 | 1.25.40.10 | 136 | 20 | 77 | 3.37 | 4.38 | |
![]() |
2v5fA00 | 80.88 | 1.25.40.10 | 97 | 13 | 59 | 2.45 | 4.12 | |
![]() |
1na3A00 | 80.87 | 1.25.40.10 | 86 | 22 | 55 | 2.35 | 4.24 |
>pdb|2hr2A00 KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAEISHTPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKAL HYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAPEFKKVVEIEERKGETPGKEREVAIDRIAQLGA
Assigning to "1.25.40.10" based on similarity with "2hr2F00"
No in_process hits for Domain "2hr2A00" ready to be processed
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process
NW result present for Domain "2hr2A00"
All required files are present for Domain "2hr2A00"
Beginning processing for Domain "2hr2A00"
nice chopping