CATH Domain: 2hr2A00 XML data for domain: 2hr2A00

Molscript image for 2hr2A00
2hr2A00
PDB coordinates for domain 2hr2A00

PDB 2hr2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.10 Gene3D
1.25.40.10.11
1.25.40.10.11.1
1.25.40.10.11.1.1
1.25.40.10.11.1.1.1
1.25.40.10.11.1.1.1.1

Segment boundaries for domain 2hr2A00

Chopping figure for domain 2hr2A00
DomainStart PDB ResidueStop PDB Residue
2hr2A00 2 157

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.25.40.10.11.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fo7A00 83.84 1.25.40.10 136 20 77 3.37 4.38
2v5fA00 80.88 Prolyl 4-hydroxylase subunit alpha-1Homo sapiensProcollagen-proline 4-dioxygenase activityMitochondrion 1.25.40.10 97 13 59 2.45 4.12
1na3A00 80.87 1.25.40.10 86 22 55 2.35 4.24
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hr2A00
KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAEISHTPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKAL
HYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAPEFKKVVEIEERKGETPGKEREVAIDRIAQLGA    

Domain COMBS Sequence

>pdb|2hr2A00
GXKPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAXEISHTXPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSA
DKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAXPEFKKVVEXIEERKGETPGKERXXEVAIDRIAQLGAS    

Domain History Events (12)

Domain assigned by auto on 14 Jan 2008 17:17

Assigning to "1.25.40.10" based on similarity with "2hr2F00"

Flow stage update by auto on 14 Jan 2008 17:06

No in_process hits for Domain "2hr2A00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:26

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2hr2A00" hits Domain "2hr2F00" (95.5974842767296% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hr2A00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hr2A00"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hr2A00"

Insertion by cuff on 06 Jul 2007 12:05

nice chopping