CATH Domain: 2hqyA02 XML data for domain: 2hqyA02

Molscript image for 2hqyA02
2hqyA02
PDB coordinates for domain 2hqyA02

PDB 2hqy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.24
3.40.630.30.24.1
3.40.630.30.24.1.1
3.40.630.30.24.1.1.1
3.40.630.30.24.1.1.1.1

Segment boundaries for domain 2hqyA02

Chopping figure for domain 2hqyA02
DomainStart PDB ResidueStop PDB Residue
2hqyA01 1 121
2hqyA01 290 298
2hqyA02 122 289

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 3.40.630.30.24.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q7bA00 80.01 Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V 3.40.630.30 161 7 76 2.77 3.61
3k9uA00 79.79 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 6 81 3.56 4.39
1s3zA00 79.66 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 5 73 2.75 3.73
2fe7A00 79.61 Pseudomonas aeruginosaProbable N-acetyltransferase 3.40.630.30 154 8 77 3.22 4.16
2fiaA00 79.54 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 6 78 3.35 4.26
1q2yA00 79.14 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 7 70 2.57 3.63
2ge3B00 79.12 Agrobacterium tumefaciens str. C58Probable acetyltransferase 3.40.630.30 159 3 73 3.50 4.74
3g8wA00 79.05 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 4 77 3.37 4.35
3d8pB00 78.94 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 7 75 2.77 3.69
3efaA00 77.99 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 3 71 2.86 4.01
2r1iA01 77.81 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 3 70 3.05 4.31
2pdoA01 77.78 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 7 68 2.74 3.98
1qsmD00 77.61 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 4 78 3.28 4.20
1xebA00 77.52 Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein 3.40.630.30 146 6 70 2.79 3.98
3e0kA00 77.46 Arginine and proline metabolismVibrio parahaemolyticusAmino-acid N-acetyltransferase [EC:2.3.1.1]Amino-acid acetyltransferaseMetabolic pathways 3.40.630.30 143 8 69 3.02 4.34
2atrA00 77.22 Acetyltransferase, GNAT familyStreptococcus pneumoniae 3.40.630.30 127 9 68 3.11 4.55
1lrzA02 77.10 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 195 9 72 3.15 4.36
2hv2A03 77.02 Enterococcus faecalisPutative uncharacterized protein 3.40.630.30 148 10 82 3.94 4.79
2qecA00 76.85 Corynebacterium glutamicumGCN5-related N-acetyltransferase 3.40.630.30 175 8 69 3.26 4.68
1sqhA02 76.33 Drosophila melanogasterCG14615 3.40.630.30 128 8 74 3.39 4.56
1y9kA01 76.08 Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation 3.40.630.30 110 2 58 2.66 4.54
2ozgA02 75.62 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 163 6 83 4.15 4.97
1lrzA01 74.99 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 143 5 68 3.32 4.82
3ey5A01 73.64 Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron 3.40.630.30 144 9 70 3.47 4.91
2fl4A02 73.54 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 3 52 2.44 4.65
1y9wA01 73.52 AcetyltransferaseBacillus cereus ATCC 14579 3.40.630.30 104 9 50 2.52 4.98
Displaying entries 1 to 26 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hqyA02
DYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNF
EALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLS
YQPVTILE    

Domain COMBS Sequence

>pdb|2hqyA02
DYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNF
EALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLS
YQPVTILE    

Domain History Events (82)

Domain assigned by cuff on 11 Feb 2008 11:06

homologous

Domain assignment manual match h by cuff on 11 Feb 2008 11:05

Lovely structural match and all top hits are in 3.40.630.30. No functional evidence but I am convinced query belongs to this superfamily

Homcheck comment by tronnberg on 14 Sep 2007 10:24

Very similar linkage and structure. The query's function is unknown.

Homcheck review by tronnberg on 22 Aug 2007 15:56

SSAP= 81, Seq= 9, OV= 89. Very similar linkage.

Flow stage update by tronnberg on 22 Aug 2007 15:56

SSAP= 81, Seq= 9, OV= 89. Very similar linkage.

Domain assignment manual match t by tronnberg on 22 Aug 2007 15:56

SSAP= 81, Seq= 9, OV= 89. Very similar linkage.

Homcheck allotment by tronnberg on 22 Aug 2007 15:45

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 22 Aug 2007 15:45

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 18 Jul 2007 09:27

Domain "2hqyA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 18 Jul 2007 09:26

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hqyA02

Flow stage update by auto on 18 Jul 2007 08:47

Retrieved PRC_PFAMCATH results for job ID SID9423653911355816 and chopping inserted.

Domain scan prc pfamcath by auto on 18 Jul 2007 08:46

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hqyA02

Update comment by auto on 18 Jul 2007 04:23

PRC_PFAMCATH job SID9423653911355816 is not yet finished.

Prc pfamcath submit by auto on 18 Jul 2007 03:53

The entry "2hqyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Jul 2007 03:53

The entry "2hqyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Jul 2007 03:15

Retrieved SSAP results for job ID SID9137715472218656 and chopping inserted.

Domain scan ssap cath by auto on 18 Jul 2007 03:13

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 420 results for 2hqyA02

Update comment by auto on 16 Jul 2007 19:54

SSAP job SID9137715472218656 is not yet finished.

Ssap cath submit by auto on 16 Jul 2007 19:43

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 19:43

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 16:57

Giving up on SSAP job SID2350957637538372 because submission time of Sat Jul 14 13:27:13 2007 is more than 172800 seconds older than current time (Mon Jul 16 16:57:14 2007).

Update comment by auto on 14 Jul 2007 13:42

SSAP job SID2350957637538372 is not yet finished.

Ssap cath submit by auto on 14 Jul 2007 13:27

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 13:27

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 07:25

Giving up on SSAP job SID5957515464191712 because submission time of Thu Jul 12 00:21:49 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:25:28 2007).

Update comment by auto on 12 Jul 2007 00:59

SSAP job SID5957515464191712 is not yet finished.

Flow stage update by auto on 12 Jul 2007 00:21

The entry "2hqyA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 12 Jul 2007 00:21

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 11 Jul 2007 22:57

Giving up on SSAP job SID2594147624667784 because submission time of Mon Jul 9 22:28:38 2007 is more than 172800 seconds older than current time (Wed Jul 11 22:57:11 2007).

Update comment by auto on 09 Jul 2007 23:05

SSAP job SID2594147624667784 is not yet finished.

Flow stage update by auto on 09 Jul 2007 22:28

The entry "2hqyA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Jul 2007 22:28

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 20:41

Giving up on SSAP job SID9614053834498048 because submission time of Sat Jul 7 16:09:06 2007 is more than 172800 seconds older than current time (Mon Jul 9 20:41:24 2007).

Update comment by auto on 07 Jul 2007 16:50

SSAP job SID9614053834498048 is not yet finished.

Ssap cath submit by auto on 07 Jul 2007 16:09

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 16:09

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 15:28

Giving up on SSAP job SID0624012867191557 because submission time of Thu Jul 5 15:25:33 2007 is more than 172800 seconds older than current time (Sat Jul 7 15:28:46 2007).

Update comment by auto on 05 Jul 2007 16:37

SSAP job SID0624012867191557 is not yet finished.

Ssap cath submit by auto on 05 Jul 2007 15:25

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 15:25

The entry "2hqyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 14:54

Retrieved PRC results for job ID SID5484630716487904 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 14:53

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hqyA02

Update comment by auto on 05 Jul 2007 10:38

PRC job SID5484630716487904 is not yet finished.

Prc cath submit by auto on 05 Jul 2007 06:37

The entry "2hqyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:37

The entry "2hqyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:19

Retrieved HMM(SAM) results for job ID SID4823761145158752 and inserted them into the database.

Domain scan sam cath by auto on 05 Jul 2007 06:18

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hqyA02

Update comment by auto on 04 Jul 2007 00:50

HMM(SAM) job SID4823761145158752 is not yet finished.

Sam cath submit by auto on 03 Jul 2007 23:05

The entry "2hqyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 23:05

The entry "2hqyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 22:21

Retrieved "2hqyA02" CATHEDRAL results for job ID SID6409229586610856 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 22:20

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 51 results for 2hqyA02

Update comment by auto on 03 Jul 2007 09:24

"2hqyA02" CATHEDRAL job SID6409229586610856 is not yet finished.

Cathedral cath submit by auto on 03 Jul 2007 08:09

The entry "2hqyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 08:09

The entry "2hqyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 07:15

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hqyA02.scanlist" for "2hqyA02"

Write scan list by auto on 03 Jul 2007 07:15

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hqyA02.scanlist" for domain "2hqyA02"

Update comment by auto on 03 Jul 2007 02:13

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:06

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:23

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:03

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:06

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:06

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:02

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:10

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:08

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:04

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:03

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:08

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:02

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:11

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:07

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:05

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:08

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:09

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:29

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:24

No satisfactory AssignClose result found.

Flow stage update by auto on 14 May 2007 06:03

No in_process hits for Domain "2hqyA02" ready to be processed

Flow stage update by auto on 14 May 2007 06:03

NW result present for Domain "2hqyA02"

Flow stage update by auto on 10 May 2007 21:59

All required files are present for Domain "2hqyA02"

Flow stage update by auto on 10 May 2007 14:08

Beginning processing for Domain "2hqyA02"

Insertion by auto on 10 May 2007 14:01

Final ChopClose added based on similarity with "2hqyB"