Domain assigned by cuff on 11 Feb 2008 11:06
homologous
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.630
| Aminopeptidase | |
3.40.630.30
| Gene3D | |
3.40.630.30.24
| ||
3.40.630.30.24.1
| ||
3.40.630.30.24.1.1
| ||
3.40.630.30.24.1.1.1
| ||
3.40.630.30.24.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hqyA01 | 1 | 121 |
| 2hqyA01 | 290 | 298 |
| 2hqyA02 | 122 | 289 |
There are 26 matching structural neighberhood comparisons for CATH ID 3.40.630.30.24.1.1.1.1 (SIMAX score < 5)
>pdb|2hqyA02 DYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNF EALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLS YQPVTILE
homologous
Lovely structural match and all top hits are in 3.40.630.30. No functional evidence but I am convinced query belongs to this superfamily
Very similar linkage and structure. The query's function is unknown.
SSAP= 81, Seq= 9, OV= 89. Very similar linkage.
SSAP= 81, Seq= 9, OV= 89. Very similar linkage.
SSAP= 81, Seq= 9, OV= 89. Very similar linkage.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2hqyA02" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hqyA02
Retrieved PRC_PFAMCATH results for job ID SID9423653911355816 and chopping inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hqyA02
PRC_PFAMCATH job SID9423653911355816 is not yet finished.
The entry "2hqyA02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2hqyA02" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID9137715472218656 and chopping inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 420 results for 2hqyA02
SSAP job SID9137715472218656 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID2350957637538372 because submission time of Sat Jul 14 13:27:13 2007 is more than 172800 seconds older than current time (Mon Jul 16 16:57:14 2007).
SSAP job SID2350957637538372 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5957515464191712 because submission time of Thu Jul 12 00:21:49 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:25:28 2007).
SSAP job SID5957515464191712 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID2594147624667784 because submission time of Mon Jul 9 22:28:38 2007 is more than 172800 seconds older than current time (Wed Jul 11 22:57:11 2007).
SSAP job SID2594147624667784 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9614053834498048 because submission time of Sat Jul 7 16:09:06 2007 is more than 172800 seconds older than current time (Mon Jul 9 20:41:24 2007).
SSAP job SID9614053834498048 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0624012867191557 because submission time of Thu Jul 5 15:25:33 2007 is more than 172800 seconds older than current time (Sat Jul 7 15:28:46 2007).
SSAP job SID0624012867191557 is not yet finished.
The entry "2hqyA02" has been submitted to the SSAP webservice.
The entry "2hqyA02" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID5484630716487904 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hqyA02
PRC job SID5484630716487904 is not yet finished.
The entry "2hqyA02" has been submitted to the PRC webservice.
The entry "2hqyA02" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID4823761145158752 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hqyA02
HMM(SAM) job SID4823761145158752 is not yet finished.
The entry "2hqyA02" has been submitted to the HMM (SAM) webservice.
The entry "2hqyA02" has been submitted to the HMM (SAM) webservice.
Retrieved "2hqyA02" CATHEDRAL results for job ID SID6409229586610856 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 51 results for 2hqyA02
"2hqyA02" CATHEDRAL job SID6409229586610856 is not yet finished.
The entry "2hqyA02" has been submitted to the CATHEDRAL webservice.
The entry "2hqyA02" has been submitted to the CATHEDRAL webservice.
ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hqyA02.scanlist" for "2hqyA02"
Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hqyA02.scanlist" for domain "2hqyA02"
Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.
Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.
Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.
Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2hqyA02" ready to be processed
NW result present for Domain "2hqyA02"
All required files are present for Domain "2hqyA02"
Beginning processing for Domain "2hqyA02"
Final ChopClose added based on similarity with "2hqyB"