CATH Domain: 2hqxA01 XML data for domain: 2hqxA01

Molscript image for 2hqxA01
2hqxA01
PDB coordinates for domain 2hqxA01

PDB 2hqx, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.140 Gene3D
2.30.30.140.3
2.30.30.140.3.1
2.30.30.140.3.1.1
2.30.30.140.3.1.1.1
2.30.30.140.3.1.1.1.1

[top]
Segment boundaries for domain 2hqxA01

Chopping figure for domain 2hqxA01
DomainStart PDB ResidueStop PDB Residue
2hqxA01 8 88

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.30.140.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sf9A02 80.02 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 11 65 2.85 4.36
1ib8A02 77.57 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 2.30.30.180 67 7 69 2.95 4.27
1mmdA01 77.12 ActomyosinMyosin II complexActin-myosin filament slidingProtein localizationActin filament binding 2.30.30.360 48 4 55 2.21 3.98
1uebA02 75.19 Thermus thermophilus HB8Elongation factor EF-PElongation factor P 2.40.50.140 63 6 48 2.23 4.63
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hqxA01
TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAF
S
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hqxA01
TQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAF
S
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 12 Feb 2008 14:17

Assigning to "2.30.30.140" based on similarity with "2hqeB01"

Flow stage update by auto on 12 Feb 2008 14:15

No in_process hits for Domain "2hqxA01" ready to be processed

Update comment by auto on 12 Feb 2008 14:13

Domain "2hqxA01" hits Domain "2hqxB01" (100% over 100%) which is currently in process

Update comment by auto on 12 Feb 2008 14:03

Domain "2hqxA01" hits Domain "2hqeB01" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2hqxA01" hits Domain "2hqeA02" (100% over 87.0967741935484%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hqxA01" hits Domain "2hqeA02" (100% over 87.0967741935484%) which is currently in process

Update comment by auto on 01 Sep 2007 06:04

Domain "2hqxA01" hits Domain "2hqeA02" (100% over 87.0967741935484%) which is currently in process

Flow stage update by auto on 01 Sep 2007 06:04

Domain "2hqxA01" hits Domain "2hqeA02" (100% over 87.0967741935484%) which is currently in process

Flow stage update by auto on 01 Sep 2007 06:04

NW result present for Domain "2hqxA01"

Flow stage update by auto on 30 Aug 2007 10:04

All required files are present for Domain "2hqxA01"

Flow stage update by auto on 29 Aug 2007 14:34

Beginning processing for Domain "2hqxA01"

Insertion by cuff on 29 Aug 2007 11:00

nice chopping