CATH Domain: 2hqmA03 XML data for domain: 2hqmA03

Molscript image for 2hqmA03
2hqmA03
PDB coordinates for domain 2hqmA03

PDB 2hqm, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.1
3.30.390.30.1.2
3.30.390.30.1.2.1
3.30.390.30.1.2.1.1
3.30.390.30.1.2.1.1.1

[top]
Segment boundaries for domain 2hqmA03

Chopping figure for domain 2hqmA03
DomainStart PDB ResidueStop PDB Residue
2hqmA01 22 172
2hqmA01 294 370
2hqmA02 173 293
2hqmA03 371 483

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.390.30.1.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nvkX03 92.05 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 31 98 1.33 1.35
1fecA03 90.80 Trypanothione reductaseCrithidia fasciculata 3.30.390.30 126 38 88 1.07 1.21
1ebdA03 88.49 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 25 96 2.60 2.69
2eq6A03 87.39 Dihydrolipoyl dehydrogenaseCitrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolism 3.30.390.30 123 30 90 2.63 2.91
2a8xA03 86.05 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 119 25 92 2.65 2.87
1xdiA03 85.50 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 19 89 2.68 3.00
1nhpA03 83.13 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.30.390.30 113 11 89 2.98 3.33
1mo9A03 82.83 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 21 71 2.15 2.99
2gqwA03 79.49 Ferredoxin reductasePseudomonas sp. KKS102 3.30.390.30 89 8 66 3.09 4.66
1m6iA03 78.60 DNA damage response, signal transduction resulting in induction of apoptosisNucleusApoptosis-inducing factor 1, mitochondrialHomo sapiensDNA fragmentation involved in apoptotic nuclear change 3.30.390.30 108 9 71 3.31 4.62
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hqmA03
NVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQ
GFGVAIKMGATKADFDNCVAIHPTSAEELVTMR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hqmA03
NVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQ
GFGVAIKMGATKADFDNCVAIHPTSAEELVTMRGSHHHHHH
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Jul 2007 10:38

Assigning to "3.30.390.30" based on similarity with "1bwcA03"

Flow stage update by auto on 28 Jul 2007 10:34

No in_process hits for Domain "2hqmA03" ready to be processed

Flow stage update by auto on 28 Jul 2007 10:34

NW result present for Domain "2hqmA03"

Flow stage update by auto on 14 Jul 2007 06:02

All required files are present for Domain "2hqmA03"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2hqmA03"

Insertion by auto on 13 Jul 2007 08:58

Final ChopClose added based on similarity with "1bwcA"