CATH Domain: 2hoxA03 XML data for domain: 2hoxA03

Molscript image for 2hoxA03
2hoxA03
PDB coordinates for domain 2hoxA03

PDB 2hox, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.14
3.90.1150.10.14.1
3.90.1150.10.14.1.1
3.90.1150.10.14.1.1.1
3.90.1150.10.14.1.1.1.1

[top]
Segment boundaries for domain 2hoxA03

Chopping figure for domain 2hoxA03
DomainStart PDB ResidueStop PDB Residue
2hoxA01 1 100
2hoxA02 101 310
2hoxA03 311 423

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ftbA01 81.45 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 9 86 3.45 3.98
1d2fB01 81.17 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 9 79 3.43 4.30
3dydA01 80.50 Tyrosine metabolismL-tyrosine:2-oxoglutarate aminotransferase activityMetabolic pathwaysPhenylalanine metabolismUbiquinone and other terpenoid-quinone biosynthesis 3.90.1150.10 137 7 71 2.59 3.62
3ffhA01 80.12 Tyrosine metabolismListeria innocuaHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismPhenylalanine metabolism 3.90.1150.10 131 7 71 3.42 4.77
5bj4A01 79.89 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Metabolic pathwaysPhenylalanine metabolism 3.90.1150.10 146 10 65 2.67 4.10
3b8xA02 79.54 Amino sugar and nucleotide sugar metabolismPutative pyridoxamine 5-phosphate-dependent dehydraseEscherichia coliCDP-6-deoxy-D-xylo-4-hexulose-3-dehydrase 3.90.1150.10 124 7 78 2.92 3.73
1jg8A02 79.14 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 7 76 3.63 4.71
1xi9B01 78.90 Pyrococcus furiosusAminotransferase [EC:2.6.1.-]Alanine aminotransferase 3.90.1150.10 144 17 68 3.03 4.41
1mdoA02 78.90 Amino sugar and nucleotide sugar metabolismUDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferaseTwo-component systemSalmonella enterica subsp. enterica serovar TyphimuriumUDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.-] 3.90.1150.10 123 15 78 3.45 4.42
1uu2B01 78.79 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 10 75 3.46 4.60
1djuB01 78.51 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Pyrococcus horikoshiiMetabolic pathways 3.90.1150.10 143 11 67 2.70 4.02
1uu1B01 77.30 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 131 10 67 3.26 4.85
1c7nA01 76.07 Treponema denticolaHemolysin 3.90.1150.10 164 7 59 2.81 4.75
1m7yA01 75.85 Malus x domestica1-aminocyclopropane-1-carboxylate synthase1-aminocyclopropane-1-carboxylate synthase activity 3.90.1150.10 163 10 57 2.39 4.14
3k40A03 75.55 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 7 76 3.54 4.60
1svvB02 75.03 Leishmania major strain FriedlinThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysPutative uncharacterized protein 3.90.1150.10 88 7 68 2.71 3.98
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hoxA03
MRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNG
VGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hoxA03
MRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNG
VGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVK
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:46

Assigning to "3.90.1150.10" based on similarity with "2hoxC03"

Flow stage update by auto on 15 Aug 2007 00:07

No in_process hits for Domain "2hoxA03" ready to be processed

Update comment by auto on 14 Aug 2007 22:50

Domain "2hoxA03" hits Domain "2hoxC03" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 10:34

Domain "2hoxA03" hits Domain "2horA03" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Jul 2007 10:34

NW result present for Domain "2hoxA03"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hoxA03"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "2hoxA03"

Insertion by auto on 14 Jul 2007 04:46

Final ChopClose added based on similarity with "1lk9B"