CATH Domain: 2ho3C02 XML data for domain: 2ho3C02

Molscript image for 2ho3C02
2ho3C02
PDB coordinates for domain 2ho3C02

PDB 2ho3, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.8
3.30.360.10.8.1
3.30.360.10.8.1.1
3.30.360.10.8.1.1.1
3.30.360.10.8.1.1.1.1

[top]
Segment boundaries for domain 2ho3C02

Chopping figure for domain 2ho3C02
DomainStart PDB ResidueStop PDB Residue
2ho3C01 1 113
2ho3C02 128 319

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.360.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h6dA02 82.24 Glucose-fructose oxidoreductase [EC:1.1.99.28]Zymomonas mobilisGlucose--fructose oxidoreductase 3.30.360.10 190 9 74 2.30 3.08
1tltA02 80.37 Virulence factorVirulence factor mviM homologEscherichia coli K-12 3.30.360.10 186 15 88 2.78 3.13
1xeaA02 79.15 Vibrio choleraeOxidoreductase, Gfo/Idh/MocA familyVirulence factor 3.30.360.10 187 8 86 3.39 3.94
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ho3C02
FTTIKNFLADQVLGADFNYAKYSSGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAG
KNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYQTWLYDAGSVH
ELLYTMRQTAGI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ho3C02
FTTIKNFLADXQVLGADFNYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSI
DLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHM
IQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFEAEK
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 11 Feb 2008 17:23

Assigning to "3.30.360.10" based on similarity with "2ho3B02"

Flow stage update by auto on 11 Feb 2008 17:21

No in_process hits for Domain "2ho3C02" ready to be processed

Update comment by auto on 11 Feb 2008 17:19

Domain "2ho3C02" hits Domain "2ho3B02" (99.4949494949495% over 100%) which is currently in process

Update comment by auto on 11 Feb 2008 17:06

Domain "2ho3C02" hits Domain "2ho5B02" (96.969696969697% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2ho3C02" hits Domain "2ho3D02" (99.4949494949495% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2ho3C02" hits Domain "2ho3D02" (99.4949494949495% over 100%) which is currently in process

Update comment by auto on 30 Aug 2007 15:27

Domain "2ho3C02" hits Domain "2ho3D02" (99.4949494949495% over 100%) which is currently in process

Flow stage update by auto on 30 Aug 2007 15:27

Domain "2ho3C02" hits Domain "2ho3D02" (99.4949494949495% over 100%) which is currently in process

Flow stage update by auto on 30 Aug 2007 15:26

NW result present for Domain "2ho3C02"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2ho3C02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2ho3C02"

Insertion by auto on 23 Aug 2007 14:49

Final ChopClose added based on similarity with "2ho3B"