CATH Domain: 2hngA00 XML data for domain: 2hngA00

Molscript image for 2hngA00
2hngA00
PDB coordinates for domain 2hngA00

PDB 2hng, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.420 Bacterial Protein-export protein SecB
3.10.420.10 Gene3D
3.10.420.10.1
3.10.420.10.1.1
3.10.420.10.1.1.1
3.10.420.10.1.1.1.1
3.10.420.10.1.1.1.1.1

[top]
Segment boundaries for domain 2hngA00

Chopping figure for domain 2hngA00
DomainStart PDB ResidueStop PDB Residue
2hngA00 4 128

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2hngA00
ANLKREQEFVSQYHFDARNFEWENENGAPETKVDVNFQLLQHDQENQVTSLIVILSFIVFDKFVISGTISQVNHIDGRIV
NEPSELNQEEVETLARPCLNLNRLTYEVTEIALDLPGINLEF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hngA00
SNAXNLKREQEFVSQYHFDARNFEWENENGAPETKVDVNFQLLQHDQENQVTSLIVILSFXIVFDKFVISGTISQVNHID
GRIVNEPSELNQEEVETLARPCLNXLNRLTYEVTEIALDLPGINLEF
BLAST against CATH

[top]
Domain History Events (81)

Domain assigned by cuff on 13 Feb 2008 14:17

i agree. same superfamily

Homcheck comment by rupa on 11 Sep 2007 11:44

After further review this still appears the most suitable option.

Domain assignment manual match h by rupa on 21 Aug 2007 10:11

High cathedral and ssap scores. Same folding. No information on function.

Homcheck review by rupa on 21 Aug 2007 10:11

High cathedral and ssap scores. Same folding. No information on function.

Flow stage update by rupa on 21 Aug 2007 10:11

High cathedral and ssap scores. Same folding. No information on function.

Homcheck allotment by rupa on 20 Aug 2007 16:56

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 20 Aug 2007 16:56

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 18 Jul 2007 09:26

Domain "2hngA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 18 Jul 2007 09:25

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hngA00

Flow stage update by auto on 18 Jul 2007 08:46

Retrieved PRC_PFAMCATH results for job ID SID9561215226036936 and chopping inserted.

Domain scan prc pfamcath by auto on 18 Jul 2007 08:46

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hngA00

Update comment by auto on 17 Jul 2007 23:19

PRC_PFAMCATH job SID9561215226036936 is not yet finished.

Prc pfamcath submit by auto on 17 Jul 2007 23:02

The entry "2hngA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Jul 2007 23:02

The entry "2hngA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Jul 2007 22:43

Retrieved SSAP results for job ID SID1188256939864192 and chopping inserted.

Domain scan ssap cath by auto on 17 Jul 2007 22:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1538 results for 2hngA00

Update comment by auto on 16 Jul 2007 19:54

SSAP job SID1188256939864192 is not yet finished.

Flow stage update by auto on 16 Jul 2007 19:43

The entry "2hngA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Jul 2007 19:43

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 16:57

Giving up on SSAP job SID4772762573494300 because submission time of Sat Jul 14 13:27:05 2007 is more than 172800 seconds older than current time (Mon Jul 16 16:57:05 2007).

Update comment by auto on 14 Jul 2007 13:42

SSAP job SID4772762573494300 is not yet finished.

Ssap cath submit by auto on 14 Jul 2007 13:27

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 13:27

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 07:25

Giving up on SSAP job SID4697332130933856 because submission time of Thu Jul 12 00:21:37 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:25:22 2007).

Update comment by auto on 12 Jul 2007 00:59

SSAP job SID4697332130933856 is not yet finished.

Ssap cath submit by auto on 12 Jul 2007 00:21

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 12 Jul 2007 00:21

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 11 Jul 2007 22:56

Giving up on SSAP job SID5301263977508640 because submission time of Mon Jul 9 22:28:30 2007 is more than 172800 seconds older than current time (Wed Jul 11 22:57:00 2007).

Update comment by auto on 09 Jul 2007 23:05

SSAP job SID5301263977508640 is not yet finished.

Ssap cath submit by auto on 09 Jul 2007 22:28

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 22:28

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 20:41

Giving up on SSAP job SID0543138466551168 because submission time of Sat Jul 7 16:08:58 2007 is more than 172800 seconds older than current time (Mon Jul 9 20:41:13 2007).

Update comment by auto on 07 Jul 2007 16:50

SSAP job SID0543138466551168 is not yet finished.

Flow stage update by auto on 07 Jul 2007 16:08

The entry "2hngA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 07 Jul 2007 16:08

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 15:28

Giving up on SSAP job SID4355352340220832 because submission time of Thu Jul 5 15:25:20 2007 is more than 172800 seconds older than current time (Sat Jul 7 15:28:39 2007).

Update comment by auto on 05 Jul 2007 16:37

SSAP job SID4355352340220832 is not yet finished.

Ssap cath submit by auto on 05 Jul 2007 15:25

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 15:25

The entry "2hngA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 14:53

Retrieved PRC results for job ID SID3862420459668928 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 14:52

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hngA00

Update comment by auto on 05 Jul 2007 10:38

PRC job SID3862420459668928 is not yet finished.

Prc cath submit by auto on 05 Jul 2007 06:37

The entry "2hngA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:37

The entry "2hngA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Jul 2007 06:18

Retrieved HMM(SAM) results for job ID SID6880389540377200 and inserted them into the database.

Domain scan sam cath by auto on 05 Jul 2007 06:18

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hngA00

Update comment by auto on 04 Jul 2007 00:50

HMM(SAM) job SID6880389540377200 is not yet finished.

Flow stage update by auto on 03 Jul 2007 23:05

The entry "2hngA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Jul 2007 23:05

The entry "2hngA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 22:20

Retrieved "2hngA00" CATHEDRAL results for job ID SID0208106176327520 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 22:20

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 73 results for 2hngA00

Update comment by auto on 03 Jul 2007 09:24

"2hngA00" CATHEDRAL job SID0208106176327520 is not yet finished.

Flow stage update by auto on 03 Jul 2007 08:09

The entry "2hngA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Jul 2007 08:09

The entry "2hngA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 07:15

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hngA00.scanlist" for "2hngA00"

Write scan list by auto on 03 Jul 2007 07:15

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hngA00.scanlist" for domain "2hngA00"

Update comment by auto on 03 Jul 2007 02:13

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:06

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:23

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:03

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:06

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:06

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:02

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:10

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:08

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:04

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:03

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:07

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:02

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:11

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:07

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:05

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:08

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:09

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:29

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:24

No satisfactory AssignClose result found.

Flow stage update by auto on 14 May 2007 06:03

No in_process hits for Domain "2hngA00" ready to be processed

Flow stage update by auto on 14 May 2007 06:03

NW result present for Domain "2hngA00"

Flow stage update by auto on 10 May 2007 21:59

All required files are present for Domain "2hngA00"

Flow stage update by auto on 10 May 2007 14:08

Beginning processing for Domain "2hngA00"

Insertion by cuff on 10 May 2007 12:32

good chopping